| Protein: 110761627 XP_001119826.1 PREDICTED: 60S ribosomal protein L24 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 56.2 | 43.8 | 1.283105 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 63 | 37 | 1.7027028 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 79.4 | 20.6 | 3.854369 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 46.7 | 53.3 | 0.8761726 | ||
| Salivary gland, thoracic | 41.7 | 7.4* | 50.9 | 0.81925344 | 0.1453831 |
| Sternite | |||||
| Tergite | 88.6 | 11.4 | 7.7719297 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.5 | 42.2 | 25.3 | 1.284585 | 1.6679842 |
| Malpighian tubules | 32.4 | 36.7 | 30.9 | 1.0485437 | 1.1877023 |
| Nerve chord | 51.6 | 7.8 | 40.7 | 1.2678133 | 0.19164619 |
| Poison sac | |||||
| Sting | |||||
| Heart | 19.4 | 42.3 | 38.3 | 0.5065274 | 1.1044387 |
| Hypopharyngeal gland | 3.1 | 96.9 | 0.031991743 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.4 | 38.6 | 40.8 | 1.0637255 | 0.9460784 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCESAHLMRRNPRKVTWTVLYRRKHK KGQEEEQAKKRTRRTQKFQRAIVGASLTDILAKRNMKPEIRKAQREQAIKAAKEQKKAAK ATKKAVVPPKTKAIPKHKAAKITQKSAPRVGGKR |
 Top
| |