| Protein: 328780157 XP_623877.2 PREDICTED: acyl carrier protein mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36 | 31.6 | 32.4 | 1.1111112 | 0.97530866 |
| Scape | 43.2 | 23.3 | 33.5 | 1.2895522 | 0.69552237 |
| Brain | 30.5 | 31.9 | 37.5 | 0.81333333 | 0.85066664 |
| Crop | 34.5 | 31 | 34.5 | 1 | 0.89855075 |
| Eye | 40 | 27.8 | 32.3 | 1.2383901 | 0.8606811 |
| Intestine | 23.3 | 32.8 | 43.8 | 0.53196347 | 0.74885845 |
| Leg, front | 27.3 | 38.1 | 34.5 | 0.79130435 | 1.1043478 |
| Leg, middle | 29.9 | 47.9 | 22.2 | 1.3468468 | 2.1576576 |
| Leg, rear | 25.7 | 34.4 | 39.9 | 0.64411026 | 0.8621554 |
| Mandibular gland | 80.4 | 19.6 | 4.102041 | ||
| Rectum | 40.2 | 59.8 | 0.6722408 | ||
| Salivary gland, cerebral | 26.5 | 35.4 | 38.1 | 0.69553804 | 0.92913383 |
| Salivary gland, thoracic | 32.6 | 36.5 | 30.8 | 1.0584415 | 1.1850649 |
| Sternite | 28.2 | 32 | 39.9 | 0.7067669 | 0.802005 |
| Tergite | 28.9 | 28.6 | 42.5 | 0.68 | 0.67294115 |
| Ventriculus | |||||
| Thoracic muscle | 41.3 | 58.7 | 0.7035775 | ||
| Fat body | 39.8 | 38.5 | 21.7 | 1.8341014 | 1.7741935 |
| Malpighian tubules | 30.4 | 31.7 | 37.9 | 0.8021108 | 0.8364116 |
| Nerve chord | 28.9 | 22 | 49.2 | 0.58739835 | 0.44715446 |
| Poison sac | |||||
| Sting | 41.8 | 58.2 | 0.7182131 | ||
| Heart | 37.6 | 29.4 | 33 | 1.1393939 | 0.8909091 |
| Hypopharyngeal gland | 92.3 | 7.7 | 11.987013 | ||
| Galea | 35.4 | 27.8 | 36.8 | 0.9619565 | 0.7554348 |
| Glossa | 36.4 | 26.6 | 36.9 | 0.98644984 | 0.7208672 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.1 | 35.5 | 36.7 | 0.95640326 | 0.96730244 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MENDNGVLVDLYIPRKCSSSNRIIHAKDHASIQLSIADVDPETGRMSDSQKMYAICGAIR RMGESDDCLGTRVKQVRQYGHKAPLSLDLIRQRVLLVLNLYDKVDVQKLSLNSHFMQDLG LDSLDHVEIIMAIEDEFGFEIPDMDAQKLLRPADIVRYVADREDVYE |
 Top
| |