| Protein: 328778481 XP_392102.3 PREDICTED: thioredoxin domain-containing protein 5-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 66.1 | 33.9 | 1.9498525 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 28.5 | 71.5 | 0.3986014 | ||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17.8 | 63.9 | 18.3 | 0.9726776 | 3.4918032 |
| Malpighian tubules | 28.7 | 20.9 | 50.4 | 0.5694444 | 0.41468254 |
| Nerve chord | 70.8 | 29.2 | 2.4246576 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 39.4 | 38.2 | 22.5 | 1.7511111 | 1.6977777 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.2 | 43.5 | 37.6 | 1.0425532 | 1.156915 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNIISLNFVMLKKHILLLIFMLSQVNSEEDHLYSVQYTKDNFSIEIQKKNHLVMFYAPWC GHCQRLEPIWEQIAKMSYNEDSNVKIAKVDCTTDSNLCAEHDVTGYPTLKFFKAGETKGI KFKGTRDLISLISFLTDHLGITFGSENIIPSPPEAVNGLLELTEDNFDKHVSSGYHFVKF YAPWCGHCQKLAPTWEELANSLRNDNYVSISKVDCTQHRSVCGQFDIKGYPTLLWIEDGK KVDKYTGQRTHEELKAYVSKMLEKENDQMDTKTDNSDSTTHAVLSLTGESFKHGIENGIS FVKFFAPWCGHCKRLAPIWKDLGKKFLTNKNVKIVKVDCTLDISKELCNEQEVDGFPTLY LYRDGLKVSEYNGARNLDDLYEFIMIYVQPHDEL |
 Top
| |