| Protein: 66499530 XP_625245.1 PREDICTED: hypothetical protein LOC551318 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 43 | 19 | 38 | 1.1315789 | 0.5 |
| Brain | 52.8 | 47.2 | 1.1186441 | ||
| Crop | 57.5 | 42.5 | 1.3529412 | ||
| Eye | |||||
| Intestine | 39.1 | 60.9 | 0.64203614 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 75.1 | 24.9 | 3.0160642 | ||
| Rectum | |||||
| Salivary gland, cerebral | 55.3 | 44.7 | 1.2371365 | ||
| Salivary gland, thoracic | 21.7 | 52.7 | 25.5 | 0.8509804 | 2.0666666 |
| Sternite | 34.2 | 38.1 | 27.7 | 1.234657 | 1.3754512 |
| Tergite | 20.1 | 27.7 | 52.2 | 0.38505748 | 0.53065133 |
| Ventriculus | |||||
| Thoracic muscle | 23.1 | 53.9 | 22.9 | 1.0087336 | 2.3537118 |
| Fat body | 47.9 | 38.3 | 13.9 | 3.4460433 | 2.7553957 |
| Malpighian tubules | 52.3 | 19.5 | 28.2 | 1.85461 | 0.69148934 |
| Nerve chord | 34.7 | 26.3 | 39 | 0.88974357 | 0.67435896 |
| Poison sac | |||||
| Sting | 44.5 | 55.5 | 0.8018018 | ||
| Heart | 43.2 | 19.5 | 37.3 | 1.1581769 | 0.5227882 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 46.4 | 15.3 | 38.3 | 1.2114882 | 0.3994778 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.6 | 35.9 | 37.4 | 1.1122994 | 0.95989305 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVKILRKVIFLDDLKPIYHKPFWEKTALLWEKFKESNPALGLFAPLAAVVIPILGGLVFY KKLHENPYPKYYEYIMVLRPDDPRVQNIRKDESLKIGLLREKDTILMRH |
 Top
| |