| Protein: 66524917 XP_393112.2 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 27 | 33.6 | 39.3 | 0.6870229 | 0.8549618 |
| Brain | 83.3* | 16.7 | 4.9880238 | ||
| Crop | 46.6 | 53.4 | 0.87265915 | ||
| Eye | |||||
| Intestine | 29.1 | 23.6 | 47.4 | 0.613924 | 0.4978903 |
| Leg, front | 37.4 | 62.6 | 0.5974441 | ||
| Leg, middle | |||||
| Leg, rear | 41.5 | 28.7 | 29.7 | 1.3973064 | 0.96633 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 61.8 | 0.5* | 37.7 | 1.6392573 | 0.013262599 |
| Salivary gland, thoracic | 51.7 | 15.5 | 32.8 | 1.5762196 | 0.47256097 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 26.5 | 39.4 | 34.1 | 0.7771261 | 1.1554252 |
| Malpighian tubules | 38.8 | 24.2 | 36.9 | 1.0514905 | 0.65582657 |
| Nerve chord | 38.1 | 21.3 | 40.5 | 0.94074076 | 0.52592593 |
| Poison sac | |||||
| Sting | |||||
| Heart | 28.7 | 37.5 | 33.8 | 0.84911245 | 1.1094675 |
| Hypopharyngeal gland | 56.3 | 43.7 | 1.2883295 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.1 | 34.2 | 39.1 | 0.97442454 | 0.8746803 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVLESTMICVDNSDYMRNGDFLPTRLQAQQDAVNLVCHSKTRSNPENNVGLITLANVEVL ATLTSDVGRILSKLHQVQPNGNLSLITGIRIAHLALKHRQGKNHKMRIVAFIGSPIEIDE KELVKLAKRLKKEKVNVDVISFGEESINNEVLTAFINALNGKDGTGSHLVTVPPGPHLSD ALISSPIIQGEDGMGGTGMGGSAYEFGVDPNEDPELALALRVSMEEQRQRQEDEARRAQA NEAATNKPPETIKEVHNEEAMLKRALAMSLEGAETSSSTADNTVPANINAPDFARMTEEE QIAFAMQMSMQDQQELESLKEEAMEVEEDYAAVMSDPAFLQSVLENLPGVDPHSEAVRQA VGSLQQNKDKDKEKEKEKDKDKDKDKDKDKDKDKDKEKK |
 Top
| |