| Protein: 328788607 XP_003251155.1 PREDICTED: hypothetical protein LOC412266 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 54.7* | 27.6 | 17.7 | 3.0903955 | 1.559322 |
| Brain | |||||
| Crop | 29.7 | 35.4 | 34.9 | 0.8510029 | 1.0143267 |
| Eye | 7.1 | 50.1 | 42.8 | 0.16588785 | 1.1705607 |
| Intestine | 59.7 | 40.3 | 1.4813895 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 95.8* | 4.2 | 22.809525 | ||
| Salivary gland, thoracic | 35.1 | 14.3 | 50.6 | 0.6936759 | 0.2826087 |
| Sternite | 79.3 | 20.7 | 3.8309178 | ||
| Tergite | 94.5* | 5.5 | 17.181818 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.3 | 36.9 | 35.8 | 0.76256984 | 1.0307263 |
| Malpighian tubules | 32.1 | 26.2 | 41.7 | 0.76978415 | 0.6282974 |
| Nerve chord | 47.1 | 4.4* | 48.5 | 0.971134 | 0.09072165 |
| Poison sac | |||||
| Sting | 54.6 | 45.4 | 1.2026432 | ||
| Heart | 21.1 | 51.7 | 27.2 | 0.7757353 | 1.9007353 |
| Hypopharyngeal gland | 21.1 | 78.9 | 0.26742712 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.9 | 42.8 | 35.3 | 1.101983 | 1.2124646 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVKIMKTGKVVLVLSGRYAGRKAIIMRNYDDGTTEKQYGHAMVAGIDRYPRKVHKRMGKA KIHKRSKIKPFVKVLNYNHLMPTRYTVDLHWDKVTPKDLKDPMKRKKIRFQTRVKFEEKY KSGKNKWFFQKLRF |
 Top
| |