| Protein: 66566109 XP_624801.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.9 | 24.4 | 30.7 | 1.4625407 | 0.7947883 |
| Scape | 49.6 | 19.7 | 30.7 | 1.6156352 | 0.64169383 |
| Brain | 48.7 | 51.3 | 0.94931775 | ||
| Crop | 27.3 | 42.9 | 29.8 | 0.91610736 | 1.4395974 |
| Eye | 74.4 | 7.5 | 18.1 | 4.1104975 | 0.41436464 |
| Intestine | 32.3 | 26.2 | 41.4 | 0.7801932 | 0.6328502 |
| Leg, front | 18.2* | 33.9 | 47.8 | 0.38075313 | 0.70920503 |
| Leg, middle | 38.1 | 29 | 32.9 | 1.1580547 | 0.88145894 |
| Leg, rear | 12.4 | 27.1 | 60.4 | 0.205298 | 0.44867548 |
| Mandibular gland | 79.9 | 20.1 | 3.9751244 | ||
| Rectum | 50 | 27.3 | 22.7 | 2.2026432 | 1.2026432 |
| Salivary gland, cerebral | 11.4 | 42.3 | 46.2 | 0.24675325 | 0.91558444 |
| Salivary gland, thoracic | 27.9 | 43.6 | 28.4 | 0.98239434 | 1.5352113 |
| Sternite | 31 | 31.8 | 37.1 | 0.8355795 | 0.85714287 |
| Tergite | 29.9 | 26.4 | 43.7 | 0.68421054 | 0.604119 |
| Ventriculus | |||||
| Thoracic muscle | 14.1 | 65.2 | 20.7 | 0.68115944 | 3.1497583 |
| Fat body | 35.8 | 42.8 | 21.4 | 1.6728972 | 2 |
| Malpighian tubules | 36.2 | 30.6 | 33.1 | 1.0936556 | 0.9244713 |
| Nerve chord | 45.5 | 19 | 35.5 | 1.2816901 | 0.53521127 |
| Poison sac | |||||
| Sting | 45.4 | 54.6 | 0.83150184 | ||
| Heart | 48.2 | 19 | 32.7 | 1.474006 | 0.5810397 |
| Hypopharyngeal gland | 80.2 | 19.8 | 4.050505 | ||
| Galea | 43.9 | 21.4 | 34.7 | 1.2651297 | 0.6167147 |
| Glossa | 50 | 11.4 | 38.6 | 1.2953368 | 0.29533678 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.2 | 33.3 | 34.7 | 1.1008645 | 0.95965415 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDPEQNFFFHFMKKLFYLLDTPVEYFREKIVIPNQKKYPCYHQNFRRVPTIDECYESDVI CRWEAQKQFERDKMVDDEILSILRQRYEDCGWYYGNDKDKYCNDLYKTYQDASTAWFIKY GDIGVPLSVVDAFMKQKHRMIWERRHGPVGSGITNKRYDI |
 Top
| |