| Protein: 328791870 XP_623949.3 PREDICTED: xaa-Pro dipeptidase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 24.1 | 75.9 | 0.31752306 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 34.7 | 14.5 | 50.8 | 0.68307084 | 0.28543308 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 29.8 | 40.3 | 29.9 | 0.9966555 | 1.3478261 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 66.7 | 33.3 | 2.0030031 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.4 | 47.5 | 0.7663158 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTEINMAESTYLNGIESCFQRGNHTLKVPMSLFQNNRKRLIERIKANKKVPDTGTFIILE GGVEIPFNDTDICWPFRQESFFQWCFGVEEPGCYGALDLSTETTILFVPRLPAEYAIWEG KLHSLEDFRKRYAIDETYYTDEIANVLKSKQAILLLTLVI |
 Top
| |