| Protein: 110757514 XP_001119838.1 PREDICTED: hypothetical protein LOC724490 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 20.1 | 34.3 | 45.6 | 0.44078946 | 0.752193 |
| Brain | 50.8 | 49.2 | 1.0325203 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 28.1 | 23.7 | 48.2 | 0.58298755 | 0.49170125 |
| Leg, middle | 45.7 | 20.6 | 33.7 | 1.356083 | 0.611276 |
| Leg, rear | 18.4 | 37.4 | 44.2 | 0.4162896 | 0.84615386 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 37.1 | 29.9 | 33 | 1.1242424 | 0.9060606 |
| Sternite | 19 | 19 | 62 | 0.30645162 | 0.30645162 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 21.2 | 64.7* | 14.1 | 1.5035461 | 4.5886526 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 33.9 | 31.2 | 34.9 | 0.9713467 | 0.8939828 |
| Glossa | 41.6 | 33.4 | 25 | 1.664 | 1.336 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 32.7 | 39 | 0.8102564 | 0.8384615 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIEKFTPGNVLLTSIFVFWTYSIYFEPRKYRLYGFFTDPQLSYARQIELKHLGKVYEPGE HLTRSMYEKK |
 Top
| |