| Protein: 110756003 XP_001119835.1 PREDICTED: dnaJ homolog subfamily A member 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.1 | 64.9 | 0.54083204 | ||
| Scape | 39.8 | 23.9 | 36.3 | 1.0964187 | 0.6584022 |
| Brain | |||||
| Crop | 53.1 | 46.9 | 1.1321962 | ||
| Eye | |||||
| Intestine | 24.5 | 48.4 | 27.2 | 0.9007353 | 1.7794118 |
| Leg, front | 50.3 | 49.7 | 1.0120724 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 59.4 | 40.6 | 1.4630542 | ||
| Salivary gland, cerebral | 41.4 | 6.7 | 52 | 0.79615384 | 0.12884615 |
| Salivary gland, thoracic | 40.9 | 25.6 | 33.5 | 1.2208955 | 0.7641791 |
| Sternite | 61.5 | 17 | 21.5 | 2.860465 | 0.7906977 |
| Tergite | 48.5 | 37.9 | 13.6 | 3.5661764 | 2.7867646 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 42.1 | 33.2 | 24.7 | 1.7044535 | 1.3441296 |
| Malpighian tubules | 36.5 | 31.1 | 32.4 | 1.1265432 | 0.95987654 |
| Nerve chord | 37.2 | 17.9 | 44.9 | 0.8285078 | 0.3986637 |
| Poison sac | |||||
| Sting | 44.2 | 55.8 | 0.7921147 | ||
| Heart | 19.5 | 47.5 | 32.9 | 0.5927052 | 1.443769 |
| Hypopharyngeal gland | 49.4 | 50.6 | 0.97628456 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.2 | 36.3 | 39.2 | 1 | 0.9260204 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVKETTFYDVLGVKPGCTQEDLKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSNPEK KRIYDQGGEQALKEGGAGGNVFSSPRDIFDMFFGGGLGGRSGRRREHRGQDVIHQLSVSL EELYKGTVRKLALQKNVICDKCEGIGGKKGSVEQCSTCHGSGMQVQIQQLGPGMLQHLQT ICVDCKGQGDRINPRDRCKQCGGRKTIRDRKILEVHVDPGMVHNQKIVFAGEGDQEPDYE PGDIVILLEEKEHEVFKRSRHDLIMRMQLELVEALCGFQKVIRTLDGRDLVITSYPGTVV KHGDLKCILNEGMPIYKDPFTHGRLIIQFVVNFPKSMDPSVIPTLEQCLPPREEVIIPEG AEDCSLMDLDPEQEVRRREQREAYEEDERGSSGVQCATN |
 Top
| |