| Protein: 66521538 XP_624302.1 PREDICTED: protein CREG1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 16.5 | 83.5 | 0.19760479 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 13.1 | 56.3 | 30.7 | 0.4267101 | 1.8338763 |
| Malpighian tubules | 28.4 | 39.8 | 31.9 | 0.89028215 | 1.247649 |
| Nerve chord | |||||
| Poison sac | 41.2 | 58.8 | 0.70068026 | ||
| Sting | 53.3 | 46.7 | 1.1413276 | ||
| Heart | 31.6 | 35.1 | 33.3 | 0.9489489 | 1.054054 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 22.4 | 45.1 | 47.5 | 0.47157896 | 0.9494737 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MILRFTIFLAFLILTIEAKKYLQFSEEEQWQEFEEYMKWKKAKEIRENGQREIKYEKRYH ENHDMYKSPKKDQQFSINNPPPINQAALMARYIVNQADWVSVATISTRQDIKSXPAVTLV SYTDGLLGNGSGIPYLYLTPLDFTAQDLAKDNRASLLMTLAQGEYCKSKQWDPMDPRCAR ILLTGKIKSLKNESMELNFAKKVFFTRHPGLVNMPEDHHFYFAKLKIISIVVLDTFGGPK YVSVEDYLHPPITNITEEFNRHFPLESYESKSQEEYSPAPNILNPVVKLV |
 Top
| |