![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66521517 XP_395319.2 PREDICTED: peroxiredoxin-6 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47 | 53 | 0.8867925 | ||
| Scape | 29.9 | 24.8 | 45.4 | 0.6585903 | 0.5462555 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 24 | 40.3 | 35.7 | 0.6722689 | 1.1288515 |
| Leg, front | 49 | 51 | 0.9607843 | ||
| Leg, middle | 54 | 46 | 1.173913 | ||
| Leg, rear | 52.2 | 47.8 | 1.0920502 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.3 | 33.2 | 33.5 | 0.9940299 | 0.99104476 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 92.1 | 7.9 | 11.658228 | ||
| Malpighian tubules | 24.8 | 45.6 | 29.6 | 0.8378378 | 1.5405406 |
| Nerve chord | 65.4 | 34.6 | 1.8901734 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 52.2 | 47.8 | 1.0920502 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.9 | 41.8 | 39.3 | 1.167939 | 1.0636132 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVLLGETFPNFVADSQMGPINFHDWLDNSWGILFSHPNDFTPVCTTELARVLKLMPEFEK LGVKVIALSCNSVDSHRKWIEDIKAYAGMTDKEFPYPIIEDETRKLATLLGMLDPLEVDN NGIPMTARAVFIIDPAKKMRLSILYPATTGRNFDEILRVIESLQLTEKHKVATPVDWKIG EEVMIQPIVSDEEAKKLYNNIKFVSLPSGKSYVRIVSQPL |
|
| |