| Protein: 66513846 XP_624613.1 PREDICTED: surfeit locus protein 4 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 19.1 | 80.9 | 0.23609394 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 45.8 | 54.2 | 0.84501845 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 57.4 | 11.9 | 30.7 | 1.8697069 | 0.38762215 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.1 | 27.2 | 50.6 | 0.4367589 | 0.53754944 |
| Malpighian tubules | 25.9 | 58.5 | 15.7 | 1.6496816 | 3.7261147 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 68.5 | 31.5 | 2.1746032 | ||
| Hypopharyngeal gland | 10.4 | 89.6 | 0.11607143 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.2 | 34.5 | 50.5 | 0.6970297 | 0.6831683 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLISQELISKAEEIADQVIRNGKHILPTLARLCLIATFLEDGLRMWFQWSEQKEFMNNSW HCGSFLATVFVFVNLIGQLGGCVMVIGRWKVSIACGILFFIVVLQTLAYNIFWDITFLFR NLALIGALLLVLAESRGEGRSLFAGVPSLGDNKPKNLLQLAGRILLAFMFTTLIRFEISF LQILQDILGSSLMVLVTIGYKTKLSALLLVLLLSALNLYHNAWWTIPEYKALRDFLKYDF FQTLSVIGGLLMIVSLGPGGVSMDEHKKEW |
 Top
| |