| Protein: 66517761 XP_392905.2 PREDICTED: cAMP-dependent protein kinase type II regulatory subunit isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.1 | 25.1 | 33.8 | 1.2159764 | 0.74260354 |
| Scape | 41.3 | 22.7 | 36 | 1.1472223 | 0.63055557 |
| Brain | 27.9 | 27.5 | 44.5 | 0.6269663 | 0.6179775 |
| Crop | 69.2 | 30.8 | 2.2467532 | ||
| Eye | |||||
| Intestine | 27 | 50.6 | 22.5 | 1.2 | 2.248889 |
| Leg, front | 40.9 | 24.2 | 34.9 | 1.1719198 | 0.69340974 |
| Leg, middle | 43.6 | 23.5 | 32.8 | 1.3292683 | 0.7164634 |
| Leg, rear | 26 | 31.9 | 42.1 | 0.6175772 | 0.7577197 |
| Mandibular gland | 35.6 | 64.4 | 0.55279505 | ||
| Rectum | |||||
| Salivary gland, cerebral | 16.4 | 36.9 | 46.8 | 0.35042736 | 0.78846157 |
| Salivary gland, thoracic | 52.4 | 20.9 | 26.7 | 1.9625468 | 0.7827715 |
| Sternite | 49.6 | 35.2 | 15.2 | 3.2631578 | 2.3157895 |
| Tergite | 76 | 24 | 3.1666667 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 58.5 | 28.4 | 13.2 | 4.431818 | 2.1515152 |
| Malpighian tubules | 47.5 | 32 | 20.4 | 2.3284314 | 1.5686275 |
| Nerve chord | 28.1 | 25.4 | 46.5 | 0.6043011 | 0.5462366 |
| Poison sac | |||||
| Sting | 44.4 | 55.6 | 0.79856116 | ||
| Heart | 49.5 | 22.3 | 28.2 | 1.7553191 | 0.7907801 |
| Hypopharyngeal gland | 60.1 | 39.9 | 1.5062656 | ||
| Galea | 30.7 | 27.6 | 41.7 | 0.736211 | 0.6618705 |
| Glossa | 34.1 | 19 | 46.8 | 0.72863245 | 0.4059829 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.9 | 31 | 35.6 | 1.1769663 | 0.8707865 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSYQRNASKIIVPDELRDVLLEFTISYLLEQPVDIIDYAIAFFTQLRESRQTQLIQDPAQ TTTSTPDESVDEEPPIIKLATRRKSVFAETYNPEEDEEDDGLKIVHPKTDAQRERLADSI KHILLFRSLDEDQMTDVLDAMFEKIVKSGEIVIRQGDDGDNFYVIERGKFEVYVRDQTDM ESLIHTYDNRGAFGELALLYNMPRAATIKAITNGTLWAMDRQTFRRILLKSAYKKRKMYE DLINKVPMLKSLEPYERMNLADALVPKHYSDGDQIIKQGDSADGMYFVEDGIVRITIRGD DGREIEINRVPAGGYLGELALVTHKPRAASAYAVGEVKLAFLDVEAFERLLGPCMELMKR NIEDYEDQIIKIFGSKTNISDIR |
 Top
| |