| Protein: 66530404 XP_625032.1 PREDICTED: proteasome subunit alpha type-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.3 | 29 | 29.6 | 1.3952702 | 0.9797297 |
| Scape | 33.8 | 31.1 | 35.1 | 0.962963 | 0.8860399 |
| Brain | 56.6 | 43.4 | 1.3041475 | ||
| Crop | 32.3 | 30.3 | 37.4 | 0.8636364 | 0.8101604 |
| Eye | 50.6 | 49.4 | 1.0242915 | ||
| Intestine | 17.3 | 51.5 | 31.2 | 0.55448717 | 1.6506411 |
| Leg, front | 28.6 | 34.8 | 36.6 | 0.78142077 | 0.9508197 |
| Leg, middle | 23.9 | 46.3 | 29.8 | 0.8020134 | 1.5536913 |
| Leg, rear | 36.7 | 26.7 | 36.7 | 1 | 0.7275204 |
| Mandibular gland | 16.8 | 83.2 | 0.20192307 | ||
| Rectum | 50.9 | 49.1 | 1.0366598 | ||
| Salivary gland, cerebral | 48.9 | 4.3 | 46.8 | 1.0448718 | 0.091880344 |
| Salivary gland, thoracic | 37.6 | 25.4 | 37 | 1.0162162 | 0.6864865 |
| Sternite | 21.7 | 46.8 | 31.5 | 0.6888889 | 1.4857143 |
| Tergite | 26.9 | 42.6 | 30.5 | 0.8819672 | 1.3967214 |
| Ventriculus | 51 | 49 | 1.0408163 | ||
| Thoracic muscle | |||||
| Fat body | 22.9 | 38.3 | 38.8 | 0.5902062 | 0.9871134 |
| Malpighian tubules | 26.7 | 32 | 41.3 | 0.6464891 | 0.7748184 |
| Nerve chord | 26.4 | 29.5 | 44.1 | 0.5986394 | 0.6689342 |
| Poison sac | |||||
| Sting | 60.8 | 39.2 | 1.5510204 | ||
| Heart | 18.9 | 46.8 | 34.3 | 0.5510204 | 1.3644315 |
| Hypopharyngeal gland | 53.7 | 46.3 | 1.1598272 | ||
| Galea | |||||
| Glossa | 19.9 | 28.5 | 51.6 | 0.38565892 | 0.5523256 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.7 | 38.3 | 41.4 | 0.7415459 | 0.9251208 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQ KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL SCDLDELIKHGLCALRDTLPNEVDLSVKNVSIAIVGKSTDFKIFNEDEISVYLSQIEDDK RNKPTEPDVEDSKPPQPPSSEETPQDPQVTVAMDTD |
 Top
| |