| Protein: 328777120 XP_003249289.1 PREDICTED: peroxiredoxin 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.4 | 33 | 25.7 | 1.6108949 | 1.2840466 |
| Scape | 30.8 | 38 | 31.2 | 0.98717946 | 1.2179487 |
| Brain | 33.6 | 36.3 | 30.1 | 1.1162791 | 1.2059801 |
| Crop | 24.7 | 53.7* | 21.6 | 1.1435186 | 2.4861112 |
| Eye | 61.2 | 22.2 | 16.6 | 3.686747 | 1.3373494 |
| Intestine | 35 | 37.6 | 27.4 | 1.2773722 | 1.3722627 |
| Leg, front | 36.5 | 30.9 | 32.6 | 1.1196319 | 0.9478528 |
| Leg, middle | 33.8 | 30.5 | 35.6 | 0.9494382 | 0.85674155 |
| Leg, rear | 45.8 | 31.1 | 23.1 | 1.982684 | 1.3463204 |
| Mandibular gland | 15.1 | 46.9 | 37.9 | 0.39841688 | 1.237467 |
| Rectum | 22.7 | 43 | 34.3 | 0.6618076 | 1.2536443 |
| Salivary gland, cerebral | 70.3 | 13.5 | 16.2 | 4.339506 | 0.8333333 |
| Salivary gland, thoracic | 32.6 | 30.8 | 36.7 | 0.8882834 | 0.83923703 |
| Sternite | 24.3 | 49 | 26.7 | 0.9101124 | 1.835206 |
| Tergite | 15.4 | 55.1 | 29.5 | 0.5220339 | 1.8677967 |
| Ventriculus | 46.9 | 29.6 | 23.5 | 1.9957447 | 1.2595744 |
| Thoracic muscle | 5.9 | 91.5* | 2.6 | 2.2692308 | 35.192307 |
| Fat body | 25.9 | 34 | 40.1 | 0.6458853 | 0.8478803 |
| Malpighian tubules | 30.8 | 45 | 24.2 | 1.2727273 | 1.8595041 |
| Nerve chord | 21.8 | 35.8 | 42.4 | 0.5141509 | 0.8443396 |
| Poison sac | 36.8 | 63.2 | 0.5822785 | ||
| Sting | 62.7 | 37.3 | 1.6809652 | ||
| Heart | 18 | 43.4 | 38.7 | 0.4651163 | 1.1214471 |
| Hypopharyngeal gland | 73.2 | 26.8 | 2.7313433 | ||
| Galea | 28.6 | 27.7 | 43.8 | 0.65296805 | 0.63242006 |
| Glossa | 23.5 | 28.9 | 47.6 | 0.49369746 | 0.60714287 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.5 | 40.8 | 31.4 | 1.0031847 | 1.299363 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAPQLQKRAPDFRGTAVVNGEFKDISLSDYQGKYLVLFFYPLDFTFVCPTEIIAFSDRAD EFEQIGCKLIAASTDSHFSHLAWVNTPRKQGGLGEMNIPLLADKSSKIARDYGVLDEESG VPFRGLFIIDDKQNLRQITINDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGKKTM KPDVVGSKEYFKDT |
 Top
| |