| Protein: 66551610 XP_392658.2 PREDICTED: sorting nexin-12-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.7 | 34.5 | 29.8 | 1.1979866 | 1.1577181 |
| Scape | 36.4 | 28.3 | 35.3 | 1.0311614 | 0.8016997 |
| Brain | 40.6 | 59.4 | 0.68350166 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 79.3* | 20.7 | 3.8309178 | ||
| Leg, front | 28.9 | 39.6 | 31.4 | 0.92038214 | 1.2611465 |
| Leg, middle | 32.8 | 39.3 | 27.9 | 1.1756272 | 1.4086021 |
| Leg, rear | 40.6 | 35.2 | 24.1 | 1.6846473 | 1.460581 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.1 | 19.8 | 36 | 1.225 | 0.55 |
| Sternite | 20.9 | 54.6 | 24.4 | 0.85655737 | 2.237705 |
| Tergite | 79.3 | 20.7 | 3.8309178 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17.6 | 63 | 19.4 | 0.9072165 | 3.2474227 |
| Malpighian tubules | 37.4 | 36.4 | 26.2 | 1.4274809 | 1.389313 |
| Nerve chord | 36 | 32.5 | 31.5 | 1.1428572 | 1.031746 |
| Poison sac | |||||
| Sting | |||||
| Heart | 35.8 | 42 | 22.2 | 1.6126126 | 1.8918918 |
| Hypopharyngeal gland | 76.9 | 23.1 | 3.3290043 | ||
| Galea | 37.8 | 34.8 | 27.4 | 1.379562 | 1.2700729 |
| Glossa | 52 | 48 | 1.0833334 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.2 | 44.3 | 29.9 | 1.2441472 | 1.4816054 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADTTVDATRRLNVKKQTLDDAYAAPANFLEIDVINPITHGVGKKRYTDYEVRMRTNLPV FKVKDSTVRRRYSDFEWLRTELERDSKIVVPPLPGKAWKRQMPFRGDDGIFEEDFIEDRR KGLEAFVNKIAGHPLAQNERCLHMFLQEPVIDKNYVPGKIRNT |
 Top
| |