| Protein: 328793281 XP_395852.4 PREDICTED: plasma alpha-L-fucosidase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21.2 | 55.8 | 23 | 0.9217391 | 2.426087 |
| Scape | |||||
| Brain | 48.5 | 51.5 | 0.94174755 | ||
| Crop | 18.2 | 59.2* | 22.5 | 0.8088889 | 2.6311111 |
| Eye | 15.4 | 50.1 | 34.5 | 0.4463768 | 1.452174 |
| Intestine | 17.6 | 39 | 43.4 | 0.40552995 | 0.8986175 |
| Leg, front | 21.6 | 61.3* | 17.1 | 1.2631578 | 3.5847952 |
| Leg, middle | 44.6* | 38.5 | 16.9 | 2.6390533 | 2.2781065 |
| Leg, rear | 55.9 | 44.1 | 1.2675737 | ||
| Mandibular gland | 9 | 91 | 0.0989011 | ||
| Rectum | 17 | 35.8 | 47.1 | 0.36093417 | 0.7600849 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 9.3* | 36 | 54.7 | 0.17001829 | 0.6581353 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 25.2 | 41.6 | 33.2 | 0.7590361 | 1.2530121 |
| Malpighian tubules | 55.4 | 44.6 | 1.2421525 | ||
| Nerve chord | 35 | 41.1 | 23.9 | 1.4644351 | 1.7196653 |
| Poison sac | |||||
| Sting | |||||
| Heart | 35 | 35.4 | 29.6 | 1.1824324 | 1.195946 |
| Hypopharyngeal gland | 86.5 | 13.5 | 6.4074073 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25 | 48.9 | 36.9 | 0.6775068 | 1.3252033 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MILSIYIVLIFSILCTSWEDQYISIITDKENYKIFRPIKAEVNKYFPTWNSLDSRPLPNW YNDAKFGIFIHWGIFSVPSFGSEWFWNNWKEEHIGTKYHDFMKQRYPPNFTYQDFAHDFT AEFFNASQWSELFQASGAKYIVLTSKHHEGYTLWPSKYSFSWNSIDVGPQKDLIGELATA IRNLTNLKFGLYYSLYEWYNPLYLFDKNNNFTTQIFVEQKIIPELYELIEKYKPEIIWSD GDWEASDDYWKSKEFLAWLYNESSVKNTVVVNDRWGQNISCHHGDFYTCSDRYNPGILLP HKWENCMTIDRKSWGFRRNAVLSEYFTLEELIKELVITVSCGGNLLMNVGPTKDGIITPI FEERLRKMGDWLKINGEAIYNTEPWTIQNDTLTYNVWYTQNKNTKQIYAIILTWPNKGVL YLGSFRATTNTQISVLGSNLLIEWKQTIEKLKIFLPAELNRGQPAWTLKIK |
 Top
| |