| Protein: 66560290 XP_392857.2 PREDICTED: lysosomal aspartic protease |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.9 | 29.4 | 27.7 | 1.5487365 | 1.0613718 |
| Scape | 36.1 | 28.2 | 35.7 | 1.0112045 | 0.789916 |
| Brain | 49 | 51 | 0.9607843 | ||
| Crop | 26.8 | 39.4 | 33.8 | 0.7928994 | 1.1656805 |
| Eye | 53.8 | 46.2 | 1.1645021 | ||
| Intestine | 17.8 | 27.6 | 54.6 | 0.32600734 | 0.5054945 |
| Leg, front | 33.6 | 36.2 | 30.2 | 1.1125828 | 1.1986755 |
| Leg, middle | 41.5 | 27.2 | 31.2 | 1.3301282 | 0.8717949 |
| Leg, rear | 33.1 | 32.9 | 34 | 0.9735294 | 0.9676471 |
| Mandibular gland | 2.9 | 57.1 | 40 | 0.0725 | 1.4275 |
| Rectum | 11.5 | 2.9 | 85.7 | 0.13418902 | 0.033838972 |
| Salivary gland, cerebral | 55.6 | 26.1 | 18.4 | 3.0217392 | 1.4184783 |
| Salivary gland, thoracic | 27.3 | 32.6 | 40.1 | 0.680798 | 0.8129676 |
| Sternite | 8.6 | 15.6* | 75.8 | 0.11345647 | 0.20580475 |
| Tergite | 7.3 | 20 | 72.7 | 0.10041265 | 0.27510315 |
| Ventriculus | 52.9 | 17.7 | 29.5 | 1.7932203 | 0.6 |
| Thoracic muscle | |||||
| Fat body | 16.5 | 17.7 | 65.8 | 0.25075987 | 0.26899695 |
| Malpighian tubules | 22.6* | 24.1 | 53.4 | 0.42322096 | 0.45131087 |
| Nerve chord | 22.8 | 29.5 | 47.7 | 0.4779874 | 0.6184486 |
| Poison sac | 56.9 | 43.1 | 1.3201857 | ||
| Sting | 13.5 | 86.5 | 0.15606937 | ||
| Heart | 17.8 | 22.5 | 59.7 | 0.29815745 | 0.37688443 |
| Hypopharyngeal gland | 55.8 | 44.2 | 1.2624434 | ||
| Galea | 99.5* | 0.5 | 199 | ||
| Glossa | 29.9 | 70.1 | 0.42653352 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.5 | 30.1 | 47.1 | 0.6687898 | 0.6390658 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFHAILCFCAFIAIANADVTRIPLHKIDSIRKQFKEYNTEIYQTHIFQGDLPQPEPLSNY LDAQYYGVISIGTPPQDFRVIFDTGSSNLWVPSKKCHLTNIACKLHRKYDNTKSSTYKKN GTDFAIRYGSGSLSGYLSTDTVDIAGMKISDQTFAEALSEPGLAFVAAKFDGILGMAYSK ISVDGVTPVFYNMVKQGLVPQPVFSFYLNRNPDDKYGGELILGGSDPNHYEGSFTYVPVD KKGYWQFRMDSIQIGSDLKVCQQGCEAIADTGTSLIAGPVKEIEAINKAIGATPIAAGEA MIDCNSIPNLPTINFVLGGKSFSLKGEDYVLKVTQFGKTVCLSGFMGMDISPPNGPLWIL GDVFIGRYYTEFDMGNNRVGFATAK |
 Top
| |