| Protein: 110749017 XP_395915.3 PREDICTED: dehydrogenase/reductase SDR family member 11-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24.7 | 43.3 | 32 | 0.771875 | 1.353125 |
| Scape | 28.6 | 55.3* | 16.2 | 1.7654321 | 3.4135802 |
| Brain | 89.3* | 10.7 | 8.345795 | ||
| Crop | 38.3 | 3.1* | 58.6 | 0.65358365 | 0.052901026 |
| Eye | 58.3 | 19.1 | 22.6 | 2.579646 | 0.84513277 |
| Intestine | 38 | 36.3 | 25.7 | 1.4785992 | 1.4124514 |
| Leg, front | 11.6 | 76* | 12.4 | 0.9354839 | 6.129032 |
| Leg, middle | 13.4 | 69.4* | 17.1 | 0.7836257 | 4.0584793 |
| Leg, rear | 73.5* | 21.6* | 4.8 | 15.3125 | 4.5 |
| Mandibular gland | 0.3 | 96.4* | 3.3 | 0.09090909 | 29.212122 |
| Rectum | |||||
| Salivary gland, cerebral | 95 | 5 | 19 | ||
| Salivary gland, thoracic | 3.4* | 84.3* | 12.3 | 0.27642277 | 6.8536587 |
| Sternite | 69.1* | 26.2* | 4.7 | 14.702127 | 5.574468 |
| Tergite | 16.9 | 81.4* | 1.7 | 9.941176 | 47.882355 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 97.6* | 2.4 | 40.666668 | ||
| Malpighian tubules | 47.3 | 13.3* | 39.4 | 1.2005076 | 0.33756346 |
| Nerve chord | 0.8 | 97.5* | 1.8 | 0.44444445 | 54.166668 |
| Poison sac | |||||
| Sting | 43.1 | 56.9 | 0.75746924 | ||
| Heart | 9.5 | 87* | 3.5 | 2.7142856 | 24.857143 |
| Hypopharyngeal gland | 99.1* | 0.9 | 110.11111 | ||
| Galea | 7.9* | 35.3 | 56.8 | 0.1390845 | 0.62147886 |
| Glossa | 21.5 | 57.1 | 21.3 | 1.0093896 | 2.680751 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31 | 58.6 | 18.6 | 1.6666666 | 3.1505377 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHRWRGKVAIVTGASAGIGAAIARALPSHDIKVVGLARNIEKLEKLADELGRDKFFPIKC DVTKEEDILKACKWVENELGGADILINNAGIIRFNALIDQKTEDYRSVLDTNLLAPAIFS REIISSIKKRNAQGHIINISSISESHLDAIFVPLGMYGASKSGLCTLGTELRNEIIVKEL NIKVTNIAPGTVVTDMITNVLGKININMPKFILLPEDIADAVIYTLGTPIRIEIPQITLI PHHESFIPKLAVEVSIISLKFL |
 Top
| |