| Protein: 48098085 XP_393971.1 PREDICTED: cytochrome P450 9e2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 4.1* | 34.3 | 61.6 | 0.06655844 | 0.5568182 |
| Scape | 13* | 12.6* | 74.4 | 0.17473118 | 0.16935484 |
| Brain | |||||
| Crop | 61.9 | 4.8* | 33.2 | 1.8644578 | 0.14457831 |
| Eye | |||||
| Intestine | 23.5 | 76.5 | 0.30718955 | ||
| Leg, front | |||||
| Leg, middle | 25.2* | 74.8 | 0.3368984 | ||
| Leg, rear | 14.2 | 4.4* | 81.4 | 0.17444718 | 0.054054055 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 9.9 | 90.1 | 0.10987791 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 16.4 | 3.1* | 80.6 | 0.20347394 | 0.038461536 |
| Malpighian tubules | 37.6 | 11.6* | 50.8 | 0.7401575 | 0.22834645 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 3.2 | 2* | 94.8 | 0.033755273 | 0.021097045 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 20.6 | 12 | 71.8 | 0.2869081 | 0.16713092 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDYLQLGLTLLAILVAVYYLSTRNHKLLKRHGIVHIPPTPLFGNLGPLVRRKCHMEDVIQ RVYDLDPDARYVGMYEFTTPLIIIRDPELIKTIGVKEITNFTNHRPFVDVGVDPMLGEVL FAMQGDRWREHRTMLTTLFTSSKIKSMFVLMSDCAKRFADYLSKVEREIELKSVLTRYTN DVIARCVYGVSVDSVNEPENIFYRYGQVASQLSTFKQNLMIFVHRNSPRLARLFNLKILP VHIEKFFHRLVMDTIETRRREGVHGLDMLQQLMDMQSRRKESEEGKRGMTVTDIANHAFS FFFGSVDTMATQISLISHMLAVNPDVQQRLQEEIDEVLSASEDKQVGYDVIQEMKYLDAV MSEAMRYHPILLFVDRVCGETFELPPALPGARPFKLERGMNIWFPVKAIHHDPKYFENPD RFDPDRFLRDGKGIASSGAYMPFGMGPRKCIGSRFALTEMKILLFNILAKCSFKVGSKTM VPLKFKEGVFNPVAKNGFWLKIERRENSCC |
 Top
| |