| Protein: 328785708 XP_394645.3 PREDICTED: hsc70-interacting protein 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.2 | 32.9 | 25.9 | 1.5907336 | 1.2702702 |
| Scape | 35.5 | 31.4 | 33.1 | 1.0725075 | 0.94864047 |
| Brain | 50.6 | 49.4 | 1.0242915 | ||
| Crop | 23.3 | 34.7 | 42 | 0.5547619 | 0.8261905 |
| Eye | |||||
| Intestine | 28.1 | 40.8 | 31 | 0.90645164 | 1.3161291 |
| Leg, front | 25 | 45.9 | 29.1 | 0.85910654 | 1.5773196 |
| Leg, middle | 18.9 | 49.3 | 31.8 | 0.5943396 | 1.5503144 |
| Leg, rear | 65.9 | 34.1 | 1.9325513 | ||
| Mandibular gland | 31.3 | 68.7 | 0.45560408 | ||
| Rectum | |||||
| Salivary gland, cerebral | 62.3 | 37.7 | 1.65252 | ||
| Salivary gland, thoracic | 36.5 | 28.9 | 34.6 | 1.0549133 | 0.8352601 |
| Sternite | 39.4 | 37.3 | 23.3 | 1.6909871 | 1.6008583 |
| Tergite | 80.1 | 19.9 | 4.0251255 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.5 | 18.3 | 46.1 | 0.77006507 | 0.39696312 |
| Malpighian tubules | 30.9 | 37.4 | 31.7 | 0.9747634 | 1.1798108 |
| Nerve chord | 36.3 | 29.1 | 34.7 | 1.0461096 | 0.8386167 |
| Poison sac | |||||
| Sting | 37.4 | 62.6 | 0.5974441 | ||
| Heart | 29.4 | 30.4 | 40.2 | 0.73134327 | 0.7562189 |
| Hypopharyngeal gland | 46.8 | 53.2 | 0.87969923 | ||
| Galea | 36 | 64 | 0.5625 | ||
| Glossa | 42 | 58 | 0.7241379 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.8 | 36.7 | 40.5 | 0.9580247 | 0.9061728 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSPALKPDVQKEMESFFHVCMANPSILNQPEYSTVKTFIEFFGGQIPKVNQQENNESPSK QSEDANISKEPEPQSEPESEEESDLELDMSAVIEPDTDAPQKMGNLTLQPTEEEIAESQA KRSEAVSAFIEKDYEKAIELYTEAIILNPQAALLYAKRGQIFLILNKPNACIRDCDRALE LNPDSAAAHKFRGRANYLLGKFEEAANDLRLACKFDFDEQADEWLREVTPNVNIFIYIEN IFIFIIIFIYQHGKLLSSN |
 Top
| |