| Protein: 48097857 XP_391959.1 PREDICTED: protein l(2)37Cc-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.9 | 33.7 | 32.4 | 1.0462962 | 1.0401235 |
| Scape | 44.2 | 23.8 | 32 | 1.38125 | 0.74375 |
| Brain | 33.6 | 29.7 | 36.7 | 0.91553134 | 0.8092643 |
| Crop | 28.4 | 37.8 | 33.8 | 0.84023666 | 1.1183432 |
| Eye | 58 | 13.9 | 28.1 | 2.0640569 | 0.49466193 |
| Intestine | 20.5 | 31.2 | 48.3 | 0.42443064 | 0.6459627 |
| Leg, front | 28.8 | 38.2 | 33 | 0.8727273 | 1.1575757 |
| Leg, middle | 27.4 | 41.8 | 30.8 | 0.8896104 | 1.3571428 |
| Leg, rear | 29.3 | 41.5 | 29.2 | 1.0034246 | 1.4212328 |
| Mandibular gland | 72.2 | 4.3 | 23.5 | 3.0723405 | 0.18297872 |
| Rectum | 29 | 44.9 | 26 | 1.1153846 | 1.7269231 |
| Salivary gland, cerebral | 30.3 | 53.5 | 16.3 | 1.8588957 | 3.2822087 |
| Salivary gland, thoracic | 32.2 | 36.7 | 31.1 | 1.0353698 | 1.1800643 |
| Sternite | 22.6 | 40.3 | 37.1 | 0.6091644 | 1.0862534 |
| Tergite | 14.8 | 37.1 | 48.1 | 0.30769232 | 0.7713098 |
| Ventriculus | 21.4 | 4.8* | 73.9 | 0.28958052 | 0.06495264 |
| Thoracic muscle | 12.1 | 74.5 | 13.4 | 0.9029851 | 5.5597014 |
| Fat body | 16.6 | 42.6 | 40.8 | 0.40686274 | 1.0441177 |
| Malpighian tubules | 29.2 | 28.8 | 42.1 | 0.6935867 | 0.6840855 |
| Nerve chord | 35.5 | 22.5 | 42 | 0.8452381 | 0.53571427 |
| Poison sac | 56 | 44 | 1.2727273 | ||
| Sting | 61.4 | 38.6 | 1.5906736 | ||
| Heart | 35 | 24.4 | 40.7 | 0.85995084 | 0.5995086 |
| Hypopharyngeal gland | 86.8 | 13.2 | 6.5757575 | ||
| Galea | 41.5 | 25.4 | 33.1 | 1.2537764 | 0.7673716 |
| Glossa | 56 | 16.7 | 27.3 | 2.0512822 | 0.61172163 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.7 | 36.6 | 34.4 | 0.9505814 | 1.0639535 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAMFWNRLGQLGLGLTLTGIVANNALYNVDGGHRAVIFDRFTGIKNQVVGEGTHFIIPWV QRPIIFDVRSRPRNIPVITGSKDLQNVNITLRILFRPIPDSLPKIYTVLGIDYAERVLPS ITNEVLKAVVAQFDAGELITQREIVSQKVREDLTERATQFGLILDDISITHLTFGKEFTQ AVEMKQVAQQEAEKARFLVEKAEQHKKAAIISAEGDAQAASLIAKSLGEAGDGLVELRRI EAAEDIAHNLSRSRQVAYLPPGQNVLLNLPQ |
 Top
| |