| Protein: 110749558 XP_001120889.1 PREDICTED: histone H2B.3-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.5 | 38.1 | 33.4 | 0.8532934 | 1.1407186 |
| Scape | 38.7 | 38.7 | 22.6 | 1.7123893 | 1.7123893 |
| Brain | |||||
| Crop | 42.1 | 10.4* | 47.5 | 0.88631576 | 0.21894737 |
| Eye | 40.3 | 59.7 | 0.67504185 | ||
| Intestine | 9* | 39 | 52 | 0.17307693 | 0.75 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 28.8 | 41 | 30.2 | 0.95364237 | 1.357616 |
| Rectum | 7.7 | 33.4 | 58.8 | 0.13095239 | 0.5680272 |
| Salivary gland, cerebral | 23 | 7.8 | 69.2 | 0.33236995 | 0.11271676 |
| Salivary gland, thoracic | 12.6* | 44.3 | 43.1 | 0.29234338 | 1.0278423 |
| Sternite | 2* | 38.2 | 59.7 | 0.03350084 | 0.639866 |
| Tergite | 0.3 | 93.1* | 6.7 | 0.04477612 | 13.895522 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 70.5 | 15.8 | 13.7 | 5.1459856 | 1.1532847 |
| Malpighian tubules | 29 | 11.3* | 59.7 | 0.48576215 | 0.18927974 |
| Nerve chord | 69.1* | 13.9 | 17 | 4.064706 | 0.81764704 |
| Poison sac | 27.8 | 72.2 | 0.38504156 | ||
| Sting | 72.6 | 27.4 | 2.649635 | ||
| Heart | 4.7 | 70.2* | 25.2 | 0.18650794 | 2.7857144 |
| Hypopharyngeal gland | 28.3 | 71.7 | 0.39470014 | ||
| Galea | 36.3 | 41.6 | 22.1 | 1.6425339 | 1.882353 |
| Glossa | 38.7 | 36.7 | 24.5 | 1.5795919 | 1.4979591 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.5 | 37.1 | 40.8 | 0.67401963 | 0.90931374 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPPKTSGKAVKKAGKAQKNISKADKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM NSFVNDVFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT SSK |
 Top
| |