| Protein: 48104021 XP_392912.1 PREDICTED: signal peptidase complex catalytic subunit SEC11C |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 23 | 46.6 | 30.3 | 0.7590759 | 1.5379539 |
| Brain | |||||
| Crop | 27.5 | 30.5 | 41.9 | 0.65632457 | 0.72792363 |
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 49.8 | 8 | 42.2 | 1.1800948 | 0.18957347 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.3 | 22.9 | 46.9 | 0.64605546 | 0.48827294 |
| Malpighian tubules | 69.5 | 30.5 | 2.2786884 | ||
| Nerve chord | 45.2 | 33.5 | 21.3 | 2.1220658 | 1.57277 |
| Poison sac | |||||
| Sting | |||||
| Heart | 15.3 | 52.8 | 31.9 | 0.47962382 | 1.6551725 |
| Hypopharyngeal gland | 8.6 | 91.4 | 0.09409191 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.9 | 34 | 42.1 | 0.7577197 | 0.807601 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLQSIFDDVRRMNKRQFLYQMLSFGMIVSSALMIWKGLMVVTGAESPIVVVLSGSMEPAF HRGDLLFLTNYQDEPVRVGEILVFKVEGRYIPIVHRVIKIHEKGDQNNTVKFLTKGDNNS VDDRGLYVTGQLWLTHKDVVGRARGFLPYVGMITIYMNEYPKFKYAILICLGLYVMVHRE |
 Top
| |