| Protein: 48105316 XP_393007.1 PREDICTED: mitochondrial import receptor subunit TOM22 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.9 | 52.1 | 0.9193858 | ||
| Scape | 31.8 | 31.9 | 36.3 | 0.87603307 | 0.8787879 |
| Brain | 37.1 | 33.2 | 29.6 | 1.2533784 | 1.1216216 |
| Crop | 41.9 | 58.1 | 0.7211704 | ||
| Eye | |||||
| Intestine | 27.1 | 34.3 | 38.6 | 0.70207256 | 0.88860106 |
| Leg, front | 33.3 | 28.8 | 37.9 | 0.87862796 | 0.75989443 |
| Leg, middle | 34.8 | 33 | 32.2 | 1.0807453 | 1.0248448 |
| Leg, rear | 29 | 27.3 | 43.6 | 0.6651376 | 0.6261468 |
| Mandibular gland | 4.1 | 95.9 | 0.04275287 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 22.9 | 47.3 | 29.8 | 0.7684564 | 1.5872483 |
| Sternite | 28.4 | 36 | 35.6 | 0.7977528 | 1.011236 |
| Tergite | 49.9 | 50.1 | 0.996008 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.8 | 58.2 | 0.7182131 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 47.8 | 52.2 | 0.91570884 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 44.1 | 55.9 | 0.7889088 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.9 | 35.5 | 47.1 | 0.7197452 | 0.7537155 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSRVDEVEEVDQSADSGMGSSDAHSPEVKSLFPDDEDDEEDESLAERLLGLTEMFPEEVR NLGYNVGTCLCNCMKGLYAFSCSAAWLFFSSSAILFAPILFEIERVQMEEAQRTQQKQVL LGPSKAMSGVSASSLPMAPPVQQ |
 Top
| |