| Protein: 48128966 XP_396639.1 PREDICTED: NADH-cytochrome b5 reductase 2-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.9 | 28.5 | 40.6 | 0.7610837 | 0.70197046 |
| Scape | 31.9 | 22.2 | 45.9 | 0.6949891 | 0.48366013 |
| Brain | 50.5 | 49.5 | 1.020202 | ||
| Crop | 38.8 | 34.3 | 26.9 | 1.4423792 | 1.275093 |
| Eye | 61.6 | 38.4 | 1.6041666 | ||
| Intestine | 34.2 | 33.2 | 32.6 | 1.0490798 | 1.018405 |
| Leg, front | 33.7 | 35.5 | 30.8 | 1.0941558 | 1.1525974 |
| Leg, middle | 31.7 | 37.5 | 30.8 | 1.0292208 | 1.2175325 |
| Leg, rear | 39.6 | 35.9 | 24.5 | 1.6163266 | 1.4653062 |
| Mandibular gland | 8.4 | 57.7 | 33.9 | 0.24778761 | 1.7020649 |
| Rectum | 14.9 | 67 | 18 | 0.8277778 | 3.7222223 |
| Salivary gland, cerebral | 46.8 | 42* | 11.2 | 4.178571 | 3.75 |
| Salivary gland, thoracic | 39.5 | 28.3 | 32.3 | 1.2229102 | 0.876161 |
| Sternite | 16.2 | 28.7 | 55.1 | 0.29401088 | 0.52087116 |
| Tergite | 18.4 | 43 | 38.6 | 0.47668394 | 1.1139896 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 18 | 24.3 | 57.6 | 0.3125 | 0.421875 |
| Malpighian tubules | 33.1 | 31.6 | 35.3 | 0.937677 | 0.89518416 |
| Nerve chord | 17.7 | 48.5 | 33.8 | 0.52366865 | 1.4349113 |
| Poison sac | |||||
| Sting | 43.7 | 56.3 | 0.7761989 | ||
| Heart | 14.1 | 44.5 | 41.4 | 0.34057972 | 1.0748792 |
| Hypopharyngeal gland | 58.9 | 41.1 | 1.43309 | ||
| Galea | 33.5 | 27.4 | 39.1 | 0.8567775 | 0.7007673 |
| Glossa | 47.4 | 17.8 | 34.8 | 1.362069 | 0.5114943 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.9 | 39.3 | 36.9 | 0.7831978 | 1.0650407 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDPADTSNISYVVSVLAAVGTIAVIGLAVKFYKCWNSDKKKKSPILLVDPVVKYSLPLI KKDILSHDTRKFRFALPTSDHILGLPIGQHVHLTVKIGDEVVIRSYTPVSSDDDHGYVDL VIKVYFKNVHPKFPEGGKMSQYLENLKIGETVDFRGPSGRLIYKGHGNFSVKILRKDPPT EYNVKKIVMLAGGTGITPMLQLIRAIIKDSTDETQTSLLFANQTEKDILLRDELDDIAKN HPNKLKLWYTLDTSSENWQYSTGHINADMIKDHMFPPSSDTMVLMCGPPPMINFACNPNL DKLGYDPKLRFAY |
 Top
| |