| Protein: 110774476 XP_001120315.1 PREDICTED: 40S ribosomal protein S19a isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.5 | 63.5 | 0.5748032 | ||
| Scape | 40.6 | 29.2 | 30.2 | 1.3443708 | 0.9668874 |
| Brain | |||||
| Crop | 18.7 | 44.7 | 36.6 | 0.510929 | 1.2213115 |
| Eye | 59.2 | 40.8 | 1.4509804 | ||
| Intestine | 13.7 | 50.4 | 35.9 | 0.3816156 | 1.4038997 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 88.7 | 11.3 | 7.8495574 | ||
| Salivary gland, thoracic | 28.9 | 28.1 | 43 | 0.67209303 | 0.6534884 |
| Sternite | 21.2 | 42.2 | 36.6 | 0.57923496 | 1.1530055 |
| Tergite | 36.1 | 48.3 | 15.6 | 2.3141026 | 3.0961537 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.7 | 34.2 | 34.2 | 0.92690057 | 1 |
| Malpighian tubules | 36.1 | 26.5 | 37.4 | 0.96524066 | 0.7085562 |
| Nerve chord | 43.7 | 13.8 | 42.6 | 1.0258216 | 0.32394367 |
| Poison sac | |||||
| Sting | 44.3 | 55.7 | 0.79533213 | ||
| Heart | 18.9 | 48.2 | 32.8 | 0.5762195 | 1.4695122 |
| Hypopharyngeal gland | 9.9 | 90.1 | 0.10987791 | ||
| Galea | |||||
| Glossa | 14.4* | 85.6 | 0.1682243 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.7 | 36.8 | 43.2 | 0.7569444 | 0.8518519 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPSVTLKDVDQHKFVKAFAAFLKKTGKMRVPEWVDIVKSARFKELAPYDPDWYYIRCAAL VRHIYIRSPIGVGAVTKIFGGRKRNGTHPSHFCRSAGGVARKALQSLEQLKLIEKSPVGG RKLTSQGRRDLDRIAAQVKAKSKKQLKLQETLVL |
 Top
| |