| Protein: 66541614 XP_624467.1 PREDICTED: aldose 1-epimerase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 64.2 | 35.8 | 1.7932961 | ||
| Scape | 22.9 | 39 | 38.2 | 0.59947646 | 1.0209424 |
| Brain | |||||
| Crop | 48.9 | 51.1 | 0.95694715 | ||
| Eye | 55.2 | 44.8 | 1.2321428 | ||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 82.6 | 17.4 | 4.7471266 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.7 | 26.4 | 42.9 | 0.7156177 | 0.61538464 |
| Sternite | 17 | 28.1 | 54.9 | 0.3096539 | 0.5118397 |
| Tergite | 12.6 | 17.3 | 70.2 | 0.17948718 | 0.24643874 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 42.8 | 57.2 | 0.74825174 | ||
| Malpighian tubules | |||||
| Nerve chord | 78.1 | 21.9 | 3.56621 | ||
| Poison sac | 10.7 | 89.3 | 0.11982083 | ||
| Sting | |||||
| Heart | 45.5 | 54.5 | 0.8348624 | ||
| Hypopharyngeal gland | |||||
| Galea | 9.6* | 37.8 | 52.6 | 0.18250951 | 0.7186312 |
| Glossa | 32.7 | 32 | 35.4 | 0.9237288 | 0.9039548 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 40.2 | 47.6 | 0.65756303 | 0.8445378 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTQFPHYIAVIVLLLLKSIMDSDGKELISVIQWGCIGNQSIEKYTLKNKVGQEVDIITY GATITSIRIPDKYGNIADIVLGFDSIEEYMMPYNPYFGATIGRVANRIKKGEFTLKGKKY HLTKNEGQNHLHGGTKGWNSKIWHADVQYNQLVLSLLSEDGDEGYPGDTIASVIFQLTKD GELCIEMKVFVTKATPINLTNHSYFNLAGHTGNASELYKHQFTINADHWTVTDAESIPTG EIRSVDNSVMDLRNSTILGDVIDKVPGGGYDYNFCLTMNDTENEKNLVATVLHPTSGRYL KVFSNQPGIQFYTANFLPESNSTGIRGKNGSEYFKHAAFCLETQNYPNAINHENFPNSIL EPGKIYHHTVVYKFGIIV |
 Top
| |