| Protein: 110755392 XP_395729.3 PREDICTED: probable dynactin subunit 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21* | 79 | 0.2658228 | ||
| Scape | 41.8 | 11.4 | 46.8 | 0.89316237 | 0.24358974 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 35.4 | 64.6 | 0.54798764 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 29.1 | 37.4 | 33.5 | 0.8686567 | 1.1164179 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 66.9 | 33.1 | 2.021148 | ||
| Malpighian tubules | 33.5 | 30.6 | 35.9 | 0.9331476 | 0.8523677 |
| Nerve chord | 51.4 | 7.9 | 40.7 | 1.2628993 | 0.1941032 |
| Poison sac | |||||
| Sting | |||||
| Heart | 35.3 | 64.7 | 0.54559505 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.3 | 31.6 | 49.8 | 0.70883536 | 0.6345382 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADPKYADLPGIAYDQVDVYETTDLPESEQFQLYPEDETDSIEKLHISATEAFNKFKNKH VISKGVDFSDRVSLKPRTGYKFGDWELPGEGEKETLIQKYQRLQCEIKELYEEVNDLKEK MGEDEVKSVAGVISQVQLLEKQLDSLKLEECLGADLVATLSDPQGTRMKQLISQIEAFKQ TSILTSDTDSKMQNIKDDKTNKTEPGVLKYQMMYLPEKARMQEAARIALLEQRLCNLESI IGTTSDKLSKFSQNLKSQGVMEALQELGAKAALLDTYQLDIIESRLATLIHRMDNIAQKK TTLTLDSEQEQKISEMYDIMKQTETMSQILPQTVNRMLALNTIHQQAATFNKSLTRLEEL QSQITSDLESNKSLLKGVQESFASNLEIIKNNIESLDERIKKLNK |
 Top
| |