| Protein: 328793701 XP_395853.3 PREDICTED: cytochrome c oxidase subunit 4 isoform 1 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.2 | 33.3 | 30.5 | 1.1868852 | 1.0918033 |
| Scape | 35.5 | 18.4 | 46.1 | 0.77006507 | 0.3991323 |
| Brain | 33.1 | 66.9 | 0.49476832 | ||
| Crop | 30.2 | 34.4 | 35.4 | 0.85310733 | 0.9717514 |
| Eye | 38.4 | 25.3 | 36.3 | 1.0578512 | 0.6969697 |
| Intestine | 34.9 | 29.8 | 35.4 | 0.9858757 | 0.8418079 |
| Leg, front | 28.1 | 33 | 38.9 | 0.722365 | 0.84832907 |
| Leg, middle | 31.8 | 44 | 24.2 | 1.3140496 | 1.8181819 |
| Leg, rear | 14.6 | 29.3 | 56.1 | 0.26024956 | 0.52228165 |
| Mandibular gland | 54.5 | 7.9 | 37.7 | 1.4456234 | 0.20954907 |
| Rectum | 27.4 | 39.4 | 33.1 | 0.82779455 | 1.1903323 |
| Salivary gland, cerebral | 31.3 | 39.6 | 29.1 | 1.0756013 | 1.3608247 |
| Salivary gland, thoracic | 13.5 | 67.1* | 19.4 | 0.6958763 | 3.458763 |
| Sternite | 22.3 | 25.7 | 51.9 | 0.42967245 | 0.49518305 |
| Tergite | 32.6 | 23.7 | 43.7 | 0.7459954 | 0.5423341 |
| Ventriculus | |||||
| Thoracic muscle | 51.8 | 48.2 | 1.0746888 | ||
| Fat body | 32.2 | 40.9 | 26.9 | 1.197026 | 1.5204461 |
| Malpighian tubules | 34.8 | 32.3 | 32.9 | 1.0577507 | 0.98176295 |
| Nerve chord | 30.3 | 40.5 | 29.2 | 1.0376712 | 1.3869863 |
| Poison sac | |||||
| Sting | 20.6 | 79.4 | 0.25944585 | ||
| Heart | 34.9 | 28.4 | 36.7 | 0.95095366 | 0.773842 |
| Hypopharyngeal gland | 75.3 | 24.7 | 3.048583 | ||
| Galea | 40.1 | 25.5 | 34.4 | 1.1656977 | 0.74127907 |
| Glossa | 34 | 26.7 | 39.3 | 0.86513996 | 0.6793893 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.8 | 33.7 | 39 | 0.84102565 | 0.86410254 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MANKLLLSYLRQNTSMCVRGLSAMPEFPNKIGNRDVVGNGWNGEEAYLDRSDFPLPAIRF KANTPDIMALREKEKAPTGEWRGHIGIALIGVSFSLLTYILLKIYAFPPLPESFNEENRL AQLERMKLLQVNPIAGISSKN |
 Top
| |