| Protein: 66546988 XP_393651.2 PREDICTED: sorbitol dehydrogenase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.8 | 74.2 | 0.34770888 | ||
| Scape | 42.8 | 57.2 | 0.74825174 | ||
| Brain | 39.4 | 60.6 | 0.650165 | ||
| Crop | 4.1* | 95.9 | 0.04275287 | ||
| Eye | |||||
| Intestine | 60.6* | 22 | 17.4 | 3.4827585 | 1.2643678 |
| Leg, front | 18.9 | 69* | 12.1 | 1.5619835 | 5.7024794 |
| Leg, middle | 22.2 | 65.8* | 12 | 1.85 | 5.483333 |
| Leg, rear | 76.1 | 11.4 | 12.5 | 6.088 | 0.912 |
| Mandibular gland | 5 | 87.5* | 7.4 | 0.6756757 | 11.824325 |
| Rectum | |||||
| Salivary gland, cerebral | 99.5* | 0.5 | 199 | ||
| Salivary gland, thoracic | 2.1* | 82.7* | 15.1 | 0.13907285 | 5.4768214 |
| Sternite | 14.1 | 41.2 | 44.7 | 0.31543624 | 0.92170024 |
| Tergite | 1* | 42.5 | 56.5 | 0.017699115 | 0.7522124 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 4.6 | 17.9 | 77.5 | 0.059354838 | 0.23096775 |
| Malpighian tubules | 26.2 | 48.2 | 25.5 | 1.027451 | 1.8901961 |
| Nerve chord | 0.5* | 90.2* | 9.2 | 0.054347824 | 9.804348 |
| Poison sac | |||||
| Sting | 25 | 75 | 0.33333334 | ||
| Heart | 0.8* | 41.4 | 57.8 | 0.01384083 | 0.716263 |
| Hypopharyngeal gland | 86.6 | 13.4 | 6.4626865 | ||
| Galea | 67.7* | 14.1 | 18.2 | 3.7197802 | 0.77472526 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.8 | 48.7 | 37.1 | 0.722372 | 1.3126684 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEFLSFDVKNHTLALRRADVPNPGPNDVRIRIAYSGICGTDLHILEGSFPCKKDGFLTLG HEFAGTVDAIGSSVKNFKVGQRVAVDPNSGCNTCNYCHDGSYQHCSAGGINSTIGIYKDG GFSTHAIVPESQVYLIPDDVELHQAVLVEPLSCLAHGWKKLNSVNVGSNVLVIGAGIIGL LWACMLHLHGLRKSVTISEPQEKRRKLVTKLDLDFEAKSPEQLKNSYDVVVDCSGSAPAI EASIPLLAPGGRLCIFGVANPKAKFSIEPFQVYLKELTILGVNINPFSFPRGLGLLRAMA DRYLNYDKLGIKVFSLSQYREALEALKRGEISKAVFKL |
 Top
| |