| Protein: 66501172 XP_392651.2 PREDICTED: ras-related protein Rab-2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.4 | 49.6 | 1.016129 | ||
| Scape | 38.8 | 23.6 | 37.6 | 1.031915 | 0.62765956 |
| Brain | 32.6 | 25 | 42.4 | 0.7688679 | 0.5896226 |
| Crop | 47.6 | 27.9 | 24.5 | 1.9428571 | 1.1387755 |
| Eye | |||||
| Intestine | 27.3 | 38.5 | 34.2 | 0.7982456 | 1.125731 |
| Leg, front | 35.1 | 34.2 | 30.7 | 1.1433225 | 1.1140065 |
| Leg, middle | 33.9 | 35.1 | 31 | 1.0935484 | 1.132258 |
| Leg, rear | 42.2 | 26.6 | 31.2 | 1.3525641 | 0.8525641 |
| Mandibular gland | 14.7 | 85.3 | 0.17233294 | ||
| Rectum | 28.8 | 34.4 | 36.8 | 0.7826087 | 0.9347826 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 41.2 | 28.3 | 30.5 | 1.3508197 | 0.92786884 |
| Sternite | 13.6 | 41.4 | 45 | 0.30222222 | 0.92 |
| Tergite | 70.3 | 29.7 | 2.3670034 | ||
| Ventriculus | 2.7 | 44.8 | 52.5 | 0.05142857 | 0.85333335 |
| Thoracic muscle | |||||
| Fat body | 33.4 | 33.1 | 33.6 | 0.99404764 | 0.98511904 |
| Malpighian tubules | 26.4 | 38.8 | 34.8 | 0.7586207 | 1.1149426 |
| Nerve chord | 20.1 | 45.4 | 34.5 | 0.5826087 | 1.315942 |
| Poison sac | |||||
| Sting | 40.7 | 59.3 | 0.68634063 | ||
| Heart | 29.8 | 35.9 | 34.3 | 0.8688047 | 1.0466472 |
| Hypopharyngeal gland | 50.9 | 49.1 | 1.0366598 | ||
| Galea | 29.4 | 27.6 | 43 | 0.68372095 | 0.6418605 |
| Glossa | 44.3 | 28.7 | 27 | 1.6407408 | 1.062963 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.1 | 34.8 | 39.8 | 0.8316583 | 0.8743719 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKPIKLQIW DTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNK SDLDNRREVRREEGEAFAREHGLVFMETSAKTAINVEDAFINTAKVIYEKIQEGVFDINN EANGIKIGPQHSPTSPSGLAGTGGQGNTQGGGCC |
 Top
| |