| Protein: 66561002 XP_397432.2 PREDICTED: translocator protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 11.3 | 88.7 | 0.12739572 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 25.4 | 74.6 | 0.34048256 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 4.4* | 31.9 | 63.7 | 0.06907378 | 0.50078493 |
| Malpighian tubules | 47.3 | 19.6 | 33.1 | 1.429003 | 0.592145 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 61.9 | 38.1 | 1.6246719 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30 | 59.6 | 0.5033557 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPVKCPVSIAIAIIHPNIGGWAGSYFSRKNIKPWYESLKKPTWTPPNWLFAPAWTTLYCT IGYSSYLVWRDGDGFRNAILPLSIYGTNLILNWSWSPLFFGLHKIKWALYEIILLWGSTA AMGVAFYNVNPYAGCLIIPYFAWTTFATALNYAIYKNNKPSIEVTANEKKE |
 Top
| |