| Protein: 328779480 XP_003249661.1 PREDICTED: hypothetical protein LOC725926 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 22.2 | 58.3* | 19.6 | 1.1326531 | 2.9744897 |
| Scape | 24.6 | 33.9 | 41.5 | 0.5927711 | 0.8168675 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 44 | 17.8 | 38.2 | 1.1518325 | 0.46596858 |
| Leg, middle | 30.2 | 25.7 | 44.1 | 0.68480724 | 0.5827664 |
| Leg, rear | 24 | 36.5 | 39.5 | 0.6075949 | 0.9240506 |
| Mandibular gland | 3.7 | 96.3 | 0.038421597 | ||
| Rectum | 18.7 | 81.3 | 0.2300123 | ||
| Salivary gland, cerebral | 26.3 | 24.5 | 49.2 | 0.5345529 | 0.49796748 |
| Salivary gland, thoracic | 79.7* | 3.9 | 16.4 | 4.859756 | 0.23780487 |
| Sternite | 16 | 38.9 | 45.1 | 0.35476717 | 0.8625277 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 75.4 | 12.8 | 11.7 | 6.4444447 | 1.0940171 |
| Malpighian tubules | 39.1 | 60.9 | 0.64203614 | ||
| Nerve chord | 26.1 | 44.1 | 29.8 | 0.87583894 | 1.4798658 |
| Poison sac | |||||
| Sting | |||||
| Heart | 29.2 | 18.4 | 52.4 | 0.55725193 | 0.35114503 |
| Hypopharyngeal gland | |||||
| Galea | 16.8 | 39.7 | 43.5 | 0.3862069 | 0.9126437 |
| Glossa | 24.1 | 40.6 | 35.3 | 0.6827195 | 1.1501416 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.1 | 29.6 | 44 | 0.7295455 | 0.6727273 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFSTSTLSVLLGTILLISSIPDAVSFSKYGRTCKDIGCMRDEVCVMAEDPCSIYQRDNCG RYPTCMKSRPGEANCASTLCGENEYCKTENGVPTCVKKSAVNDDGLFAEFDGTSNSLLRK RRGTGDEADSTPDDTQSVKTMDSRYPSGSGYPSSETRPKTDTSVKSSGYPSSSGYPSTGS SGYPSSSGYPSSSGYPSRSSGYPSESASSGYPSRSSGYPSETGYPSRSSSGYPSQSGYPS RSSSGYPSESGYPSRSSYPSGSSYPSGSYPSSGSRGYPSTSVDEASVKRVDANSVNAAYP SQAGRSSSGYPSQGSSYPSQSSGYPGQSGGYPSQSSGYPGQGYPSSGYPGQSGRSDYPSQ YGGYPSQSNPYGSYYPGYNQGYQQGYSGGYQQGYPGGYQQGYQGGYSPPSTTRKPKFTDQ LGTIAKDLAGKYLTQAILDKVTRY |
 Top
| |