| Protein: 66518279 XP_393723.2 PREDICTED: ras-related protein Rab-10 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 51.6 | 48.4 | 1.0661157 | ||
| Scape | 44 | 13.9 | 42.1 | 1.0451306 | 0.33016628 |
| Brain | |||||
| Crop | 58.5 | 14.2 | 27.4 | 2.1350365 | 0.5182482 |
| Eye | |||||
| Intestine | 35.8 | 28.3 | 35.9 | 0.9972145 | 0.7883008 |
| Leg, front | 27 | 38 | 35 | 0.7714286 | 1.0857143 |
| Leg, middle | 24.9 | 35.3 | 39.8 | 0.6256281 | 0.8869347 |
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 38.9 | 26.4 | 34.7 | 1.1210375 | 0.7608069 |
| Sternite | 35.6 | 64.4 | 0.55279505 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 47.3 | 23.8 | 28.9 | 1.6366782 | 0.8235294 |
| Malpighian tubules | 27.6 | 38.5 | 33.8 | 0.8165681 | 1.1390532 |
| Nerve chord | 37.6 | 39 | 23.3 | 1.6137339 | 1.6738198 |
| Poison sac | |||||
| Sting | |||||
| Heart | 34.4 | 33.1 | 32.5 | 1.0584615 | 1.0184616 |
| Hypopharyngeal gland | 22 | 78 | 0.2820513 | ||
| Galea | 54.4 | 45.6 | 1.1929824 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.8 | 28.4 | 40.7 | 0.977887 | 0.6977887 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFSTTFISTIGIDFKIKTVELRGKKIKL QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKTFENIVKWLRNIDEHANEDVEKMIL GNKSDMEDKRVVSTERGEAIAREHGIRFMETSAKANINIDRAFSELAEAILEKTHGKEPQ DAPDRVTVDRRVERNSNRCC |
 Top
| |