| Protein: 283436150 NP_001164443.1 adenylate kinase 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 19.8 | 34.4 | 45.8 | 0.4323144 | 0.7510917 |
| Brain | 66.6 | 33.4 | 1.994012 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 84.9* | 15.1 | 5.6225166 | ||
| Leg, front | 41.9 | 26.5 | 31.6 | 1.3259493 | 0.8386076 |
| Leg, middle | 41.2 | 25.9 | 32.9 | 1.2522796 | 0.78723407 |
| Leg, rear | 31.1 | 29.7 | 39.2 | 0.7933673 | 0.75765306 |
| Mandibular gland | 62.5 | 37.5 | 1.6666666 | ||
| Rectum | |||||
| Salivary gland, cerebral | 10.6 | 41.5 | 47.9 | 0.22129436 | 0.8663883 |
| Salivary gland, thoracic | 21.3 | 60.9* | 17.8 | 1.1966292 | 3.4213483 |
| Sternite | 80.1 | 19.9 | 4.0251255 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 52.7 | 39.7* | 7.6 | 6.9342103 | 5.2236843 |
| Malpighian tubules | |||||
| Nerve chord | 35.2* | 49.5 | 15.3 | 2.3006537 | 3.235294 |
| Poison sac | |||||
| Sting | 19.8 | 80.2 | 0.2468828 | ||
| Heart | 84.1* | 14* | 1.9 | 44.263157 | 7.368421 |
| Hypopharyngeal gland | 97.6* | 2.4 | 40.666668 | ||
| Galea | 9.9* | 41.7 | 48.4 | 0.20454545 | 0.86157024 |
| Glossa | 5.7* | 55 | 39.3 | 0.14503817 | 1.3994911 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.2 | 45.9 | 30.4 | 1.2565789 | 1.5098684 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIVWIIGGPGCGKGTQCKRIIEKYGFYHISSGDLLREEVARGSPQGTFLQETMSKGLFV STDIVLDLIKERMQKVKQEKMTNTGFLIDGYPRELGQGLLFEKNVCPVDLIIFFDASSEI LEKRLLGRAEVLKRADDNQETIKNRIKLFNMNRHAEIIEHYKDKVVKIDANGNEDEIFDE VVKVINTLLNES |
 Top
| |