| Protein: 328787617 XP_394468.4 PREDICTED: valacyclovir hydrolase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 18.7 | 81.3 | 0.2300123 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 41.5 | 25 | 33.5 | 1.238806 | 0.74626863 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 98.9* | 1.1 | 89.90909 | ||
| Mandibular gland | 78.1 | 21.9 | 3.56621 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 33.8 | 12.8 | 53.4 | 0.6329588 | 0.23970038 |
| Malpighian tubules | 16.6* | 45.3 | 38.1 | 0.43569553 | 1.1889764 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 4 | 42.3 | 53.7 | 0.074487895 | 0.7877095 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.5 | 28.8 | 40.4 | 1.1262376 | 0.7128713 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLVKLYGSFVNNFPFQRTYIVNFFSRNNARLFSTMKNYISQEKKININGVNINYLKIGTG NPVLLLPGAAGSIWTDFKPQIEGLDKEKFTIVAWDPPGYGKSRPPDRTYPDDFFQRDATW ACDLMKALGYTKFSLIGWSDGGITSLMLASMFPDNVQKMVALAANAYVTPEEKEIYKKYG IIDNWSEKMKQPLIKVYGEEYLRKISFDWLESILRICEKQNDDLCKESLKKIKCPSLIVQ GNKDPMVLIEHASYLKDHIVGSKIKIFEKA |
 Top
| |