![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328783763 XP_624194.2 PREDICTED: aquaporin AQPcic-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 61.9 | 38.1 | 1.6246719 | ||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 3.9* | 12.6* | 83.5 | 0.046706587 | 0.1508982 |
| Tergite | 1.9 | 98.1 | 0.019367993 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 2.1* | 27 | 70.9 | 0.029619182 | 0.38081804 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 44.6 | 55.4 | 0.8050541 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 17.4 | 28.1 | 69.2 | 0.25144508 | 0.40606937 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSNDLRSGFKKLMHGEGALKNTVLTALAEMIGTSMLVFLGCMGCVGSLGVVPSHFQIAL TFGLAVMIVIQSLGHISLAHINPAITVGSVVLGMKTIPEGLVYLLSQVVGGVLGFGMLKV VTPAGRMTGKSPDEADMFCVTELHTELSAIQGLLLEGISTAVLMLVACAVWDSRNAKNTD SVPIRFGLTVAALALAVGPYTGCSMNPARSLAPALWNNQWSHHWIYWFGPIGGALLSSFT YKTIFGVKRNEQEEPAAEAVALNSVDTQKAEP |
|
| |