| Protein: 328789071 XP_623458.3 PREDICTED: hydroxyacylglutathione hydrolase mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.5 | 43.7 | 28.8 | 0.9548611 | 1.5173612 |
| Scape | 26.2 | 49.7 | 24.1 | 1.087137 | 2.0622406 |
| Brain | 51.8 | 48.2 | 1.0746888 | ||
| Crop | 61.7 | 12.5 | 25.7 | 2.4007783 | 0.48638132 |
| Eye | 57.5 | 42.5 | 1.3529412 | ||
| Intestine | 31.2 | 30.6 | 38.2 | 0.8167539 | 0.80104715 |
| Leg, front | 38.2 | 31.2 | 30.6 | 1.248366 | 1.0196079 |
| Leg, middle | 29.5 | 42.9 | 27.6 | 1.0688406 | 1.5543479 |
| Leg, rear | 33.2 | 35.4 | 31.4 | 1.0573249 | 1.1273885 |
| Mandibular gland | 10.1 | 89.9 | 0.11234705 | ||
| Rectum | |||||
| Salivary gland, cerebral | 36.2 | 23.6 | 40.2 | 0.9004975 | 0.5870647 |
| Salivary gland, thoracic | 37.4 | 28.4 | 34.2 | 1.0935673 | 0.83040935 |
| Sternite | 36.8 | 37.9 | 25.2 | 1.4603175 | 1.5039682 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 55.6 | 18 | 26.4 | 2.1060605 | 0.6818182 |
| Malpighian tubules | 30.3 | 35.6 | 34.1 | 0.88856304 | 1.0439882 |
| Nerve chord | 26.5 | 41.8 | 31.8 | 0.8333333 | 1.3144654 |
| Poison sac | |||||
| Sting | 48.6 | 51.4 | 0.9455253 | ||
| Heart | 37.4 | 32.5 | 30.1 | 1.2425249 | 1.0797342 |
| Hypopharyngeal gland | 56.9 | 43.1 | 1.3201857 | ||
| Galea | 47.7 | 52.3 | 0.9120459 | ||
| Glossa | 17.5 | 52.5 | 30 | 0.5833333 | 1.75 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.5 | 38.9 | 37.4 | 0.8957219 | 1.0401069 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLNAMSRASPIWLTLTSLYYKAKSIPTNGFYSTYSNRVIIKQFKKYDMKVQILPALQDNY MYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHAGGNIKLCKKFNNL QVYGGDERIEALTCKVKHNDIFNIGKLQVQCLSTPCHTTGHICYYITENQDVPAVFTGDT LFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEPENEAIRQ KIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQKDPIQTMAFLRREKDNF KA |
 Top
| |