| Protein: 66509032 XP_623527.1 PREDICTED: 26S protease regulatory subunit 4 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.2 | 74.8 | 0.3368984 | ||
| Scape | 33.7 | 29.5 | 36.8 | 0.9157609 | 0.80163044 |
| Brain | |||||
| Crop | 31.9 | 27.4 | 40.7 | 0.7837838 | 0.67321867 |
| Eye | |||||
| Intestine | 31.3 | 35.7 | 33 | 0.94848484 | 1.0818182 |
| Leg, front | 45.5 | 54.5 | 0.8348624 | ||
| Leg, middle | 33.4 | 24.1 | 42.5 | 0.78588235 | 0.5670588 |
| Leg, rear | 65.8 | 34.2 | 1.9239767 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 23.5* | 76.5 | 0.30718955 | ||
| Sternite | 43.1 | 30.5 | 26.5 | 1.6264151 | 1.1509434 |
| Tergite | 32 | 36.8 | 31.1 | 1.0289389 | 1.1832798 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 29.6 | 32.9 | 37.5 | 0.78933334 | 0.87733334 |
| Malpighian tubules | 35.6 | 26.2 | 38.2 | 0.93193716 | 0.68586385 |
| Nerve chord | 45.8 | 54.2 | 0.84501845 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 18.4 | 40.9 | 40.7 | 0.45208845 | 1.004914 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.3 | 31.6 | 44.4 | 0.795045 | 0.7117117 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGQNQSGTGGTGSDKKDDKDKKKKYEPPIPTRVGKKKRRTKGPDAALKLPQVTPHTRCRL KLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNH AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAP QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSG GEREIQRTMLELLNQLDGFDSRGDVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKT KRRIFSIHTSRMTLAPDVNLAELIMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFK KSKESVLYRKKEGSPEGLYL |
 Top
| |