| Protein: 328785087 XP_624958.3 PREDICTED: proteasome subunit beta type-3-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.9 | 47.1 | 1.1231422 | ||
| Scape | 30 | 40.2 | 29.8 | 1.0067114 | 1.3489933 |
| Brain | 59.5 | 40.5 | 1.4691358 | ||
| Crop | 35.2 | 29.7 | 35.1 | 1.002849 | 0.84615386 |
| Eye | |||||
| Intestine | 70.3 | 29.7 | 2.3670034 | ||
| Leg, front | 51.7 | 48.3 | 1.0703933 | ||
| Leg, middle | |||||
| Leg, rear | 62.8 | 37.2 | 1.6881721 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.3 | 29.3 | 31.3 | 1.255591 | 0.9361022 |
| Sternite | 27.8 | 41.2 | 31 | 0.8967742 | 1.3290323 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 18.6 | 38.9 | 42.5 | 0.43764704 | 0.9152941 |
| Malpighian tubules | 26.7 | 33.6 | 39.7 | 0.67254406 | 0.84634763 |
| Nerve chord | 24.6 | 38.3 | 37.2 | 0.66129035 | 1.0295699 |
| Poison sac | |||||
| Sting | |||||
| Heart | 18.8 | 44.1 | 37.1 | 0.50673854 | 1.1886792 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 30.3 | 69.7 | 0.43472022 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.4 | 43.3 | 39.7 | 0.84130985 | 1.0906801 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTITCDFQKIFEMGSHLYLSLPGLATDT QTVMEKLRFRLNLYELKENRKIHPKAFASMVSNLLYERRFGPYFVEPIIAGLNPNTYEPF ICNMDLIGCISPSNDFVVGGTCTEQLYGMCESLYEPDMEPDDLFETISQALVNACDRDAI SGWGAIVYIIEKDKITVKTLKTRMD |
 Top
| |