| Protein: 328791773 XP_001121974.2 PREDICTED: acetyl-CoA acetyltransferase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25 | 41.3 | 33.7 | 0.74183977 | 1.2255193 |
| Scape | 30.5 | 35.6 | 33.8 | 0.9023669 | 1.0532545 |
| Brain | 80.3* | 19.7 | 4.0761423 | ||
| Crop | 40.5 | 31.5 | 28 | 1.4464285 | 1.125 |
| Eye | |||||
| Intestine | 34.8 | 36.3 | 28.9 | 1.2041522 | 1.2560554 |
| Leg, front | 52.6 | 47.4 | 1.1097046 | ||
| Leg, middle | 61.1 | 38.9 | 1.5706941 | ||
| Leg, rear | 55.8 | 31.2 | 13 | 4.292308 | 2.4 |
| Mandibular gland | |||||
| Rectum | 28.3 | 71.7 | 0.39470014 | ||
| Salivary gland, cerebral | 94.2 | 0.5 | 5.3 | 17.773584 | 0.094339624 |
| Salivary gland, thoracic | 15.3* | 47.6 | 37.1 | 0.41239893 | 1.2830188 |
| Sternite | 88.2* | 11.8 | 7.4745765 | ||
| Tergite | 64.8 | 35.2 | 1.8409091 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 16.9 | 34.2 | 48.9 | 0.34560326 | 0.6993865 |
| Malpighian tubules | 31 | 41.3 | 27.7 | 1.1191336 | 1.4909748 |
| Nerve chord | 32.3 | 40.7 | 26.9 | 1.2007434 | 1.5130111 |
| Poison sac | |||||
| Sting | 25.8 | 74.2 | 0.34770888 | ||
| Heart | 18.8 | 37.5 | 43.7 | 0.43020594 | 0.85812354 |
| Hypopharyngeal gland | 85 | 15 | 5.6666665 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.9 | 45.5 | 33.7 | 1.0652819 | 1.3501483 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTIIKSSFCYSNSINCSICWPISEISATRTPMGSFLGELSDLSAPKLGAITIQAAVERA GIPKDKITEVYMGNVCQAFLGQAPARQATLFAGLSKSTICTTVNKVCASGMKSIMLASQS LQCGHQEIVLAGGMESMSNVPFYLPRKEIKYGSIKLEMGIVFDGLTDVYNKFHMGNCAEN VAKKLNITRDEQDEYAINSYKRSAAAYVNKIFQNELVSVPVPQKKGNPNKIFNEDEEYKK VDFVKFAKLNTVFQKNGTITAGNASTLNDGAAALILTTTTIAEKMNLKPLARIIAFQDTA IEPIDFSIAPSFSISKLLENTGVNKNDIALWEINEAFSVVVIANQKLLDLDPNKVNIHGG AVSLGHPIGMSGARIVVHLVHALKTGEKGIASICNGGGGASSILIEKL |
 Top
| |