| Protein: 66511756 XP_624052.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57.1 | 42.9 | 1.3310024 | ||
| Scape | 48.9 | 11.6* | 39.6 | 1.2348485 | 0.2929293 |
| Brain | 24.1 | 75.9 | 0.31752306 | ||
| Crop | 37.6 | 21.5 | 40.8 | 0.92156863 | 0.5269608 |
| Eye | |||||
| Intestine | 33.6 | 33.6 | 32.8 | 1.0243902 | 1.0243902 |
| Leg, front | 10.8* | 37.2 | 52 | 0.20769231 | 0.7153846 |
| Leg, middle | 50.4 | 20.1 | 29.5 | 1.7084745 | 0.68135595 |
| Leg, rear | 7.5* | 28.3 | 64.2 | 0.11682243 | 0.44080997 |
| Mandibular gland | 40.9 | 9.7 | 49.4 | 0.8279352 | 0.19635628 |
| Rectum | 37.2 | 39.7 | 23.1 | 1.6103896 | 1.7186147 |
| Salivary gland, cerebral | 11.3 | 42.9 | 45.8 | 0.24672489 | 0.9366812 |
| Salivary gland, thoracic | 28.1 | 43.3 | 28.5 | 0.9859649 | 1.5192982 |
| Sternite | 38.2 | 23.1 | 38.7 | 0.9870801 | 0.5968992 |
| Tergite | 52.7 | 47.3 | 1.114165 | ||
| Ventriculus | |||||
| Thoracic muscle | 42 | 58 | 0.7241379 | ||
| Fat body | 39.9 | 35.5 | 24.6 | 1.6219512 | 1.4430895 |
| Malpighian tubules | 34.2 | 38.5 | 27.3 | 1.2527473 | 1.4102564 |
| Nerve chord | 32.8 | 30 | 37.2 | 0.8817204 | 0.8064516 |
| Poison sac | |||||
| Sting | 30.6 | 69.4 | 0.4409222 | ||
| Heart | 45.5 | 21.3 | 33.2 | 1.370482 | 0.6415663 |
| Hypopharyngeal gland | 70 | 30 | 2.3333333 | ||
| Galea | 22.1 | 53 | 25 | 0.884 | 2.12 |
| Glossa | 66.5 | 8 | 25.5 | 2.6078432 | 0.3137255 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.9 | 31.1 | 40.9 | 0.90220046 | 0.7603912 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAALKTTVNLSKKLFVRNITLTSFARKYDKIVDTPYEEILQNELSVSQKKYMPGLYPKTK EEMKAAAEKYGLHPDEYKPCDPDTNYAGDYPDLPFISVEAKDPYYPWDFPALRRNFEEPI HKEANMLFGDRYEYGVRQIVEPSKGIAIFCSIMAACILIFWLSCNISQPLMEKQYPGKGI HYTFELK |
 Top
| |