| Protein: 328782267 XP_623922.2 PREDICTED: zinc carboxypeptidase A 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 84.4* | 15.6 | 5.4102564 | ||
| Eye | |||||
| Intestine | 43.6* | 44* | 12.4 | 3.516129 | 3.548387 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 24.1 | 10 | 65.9 | 0.3657056 | 0.15174507 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 18.9 | 81.1 | 0.23304562 | ||
| Ventriculus | 33.5* | 64.2* | 2.2 | 15.227273 | 29.181818 |
| Thoracic muscle | |||||
| Fat body | 86.6 | 13.4 | 6.4626865 | ||
| Malpighian tubules | 47.8 | 23.1 | 29.2 | 1.6369863 | 0.7910959 |
| Nerve chord | 9.9 | 56.2 | 33.8 | 0.2928994 | 1.6627219 |
| Poison sac | |||||
| Sting | 77* | 23 | 3.347826 | ||
| Heart | 29.9 | 47.1 | 23.1 | 1.2943723 | 2.038961 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.8 | 50.8 | 30 | 1.2266667 | 1.6933334 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MWKLIFIGLLGLAIAEKIKYDNYKVFRIAPQTKEQFEIVRNLEDVSDAFSFWKEPNAEGI ADIMVAPHKIPEFYDMMMKLDIPYDIYINNVQDLIDSEASPIQPLVTFNFAQYHTLEEIY AYLDYLAKANPKVEVVVGGKTYEGRQIKGVKLNFGTNKPGIFLEGGIHAREWITPATLLY ITNELLHSNNTDVRALAESHNWYIFPIFNPDGYVYTHTTNRLWRKTRKPYGLLCYGTDPN RNWGYKWMSGGASTNPCSETYAGSSAFSDVETKSLSEFISSISNKFSAYVAFHSYSQLLM FPYGHTKDHLENYNDELAIGKKAIQALAKRYGTQYQTGNIAETIYIASGSSMDWVKGTFH KPITYTYELRDTGRYGFLLPANQIIPTSQETLDSLIAMFKEAKVRGYK |
 Top
| |