| Protein: 221325614 NP_001138311.1 C1q-like venom protein precursor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.1 | 58.9 | 0.6977929 | ||
| Scape | 9.2 | 73.5* | 17.4 | 0.52873564 | 4.224138 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 67.6 | 32.4 | 2.0864198 | ||
| Leg, middle | 67.8 | 32.2 | 2.10559 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 53.1 | 46.9 | 1.1321962 | ||
| Tergite | 10.5 | 89.5 | 0.11731844 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17.6 | 82.4 | 0.21359223 | ||
| Malpighian tubules | |||||
| Nerve chord | 86.8* | 13.2 | 6.5757575 | ||
| Poison sac | 29.7 | 70.3 | 0.4224751 | ||
| Sting | 71.6 | 28.4 | 2.5211267 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 27.6 | 26.7 | 45.7 | 0.60393876 | 0.5842451 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 21.2 | 59.6 | 47 | 0.45106384 | 1.2680851 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVVWLVLIATSSSVYLAEAAIPDPPNSKISTVNPSKLSTAVDCTGIIAFSATHASVDHAK AVFAETLVDKGVGYVPQTGIFITNCPGLYQFSFAGYGSTDLRLTLKKKQNNSDSWRPVVG TGAGGGANLILLEVDVGDQLAVFVDSGKISDGVTFSGYRIAKI |
 Top
| |