| Protein: 66508940 XP_397201.2 PREDICTED: complement component 1 Q subcomponent-binding protein mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.8 | 30.4 | 33.7 | 1.0623145 | 0.90207714 |
| Scape | 40.8 | 32.4 | 26.8 | 1.5223881 | 1.2089552 |
| Brain | 46.2 | 53.8 | 0.85873604 | ||
| Crop | 25.9 | 30.2 | 43.9 | 0.5899772 | 0.6879271 |
| Eye | 39.2 | 22.7 | 38.1 | 1.0288714 | 0.5958005 |
| Intestine | 31.7 | 24.3 | 44 | 0.7204546 | 0.55227274 |
| Leg, front | 38.9 | 20.7 | 40.5 | 0.9604938 | 0.51111114 |
| Leg, middle | 34.3 | 25.1 | 40.6 | 0.8448276 | 0.6182266 |
| Leg, rear | 47.9 | 26.8 | 25.3 | 1.8932806 | 1.0592885 |
| Mandibular gland | 41.7 | 1.6 | 56.7 | 0.73544973 | 0.028218696 |
| Rectum | 35 | 16.7 | 48.3 | 0.7246377 | 0.3457557 |
| Salivary gland, cerebral | 54.8 | 28.3 | 16.9 | 3.2426035 | 1.6745563 |
| Salivary gland, thoracic | 28.2 | 38.2 | 33.5 | 0.84179103 | 1.1402985 |
| Sternite | 51.5 | 28.9 | 19.6 | 2.627551 | 1.4744898 |
| Tergite | 16.4 | 45 | 38.6 | 0.42487046 | 1.1658031 |
| Ventriculus | 46.1 | 27.7 | 26.3 | 1.7528517 | 1.053232 |
| Thoracic muscle | 4 | 75 | 21 | 0.1904762 | 3.5714285 |
| Fat body | 39.5 | 34.2 | 26.3 | 1.5019011 | 1.3003802 |
| Malpighian tubules | 31.3 | 33.3 | 35.3 | 0.88668555 | 0.9433428 |
| Nerve chord | 42.6 | 13.1 | 44.3 | 0.9616253 | 0.29571107 |
| Poison sac | |||||
| Sting | 46 | 54 | 0.8518519 | ||
| Heart | 37.2 | 22.7 | 40.1 | 0.9276808 | 0.5660848 |
| Hypopharyngeal gland | 59.5 | 40.5 | 1.4691358 | ||
| Galea | 28.6 | 26.9 | 44.5 | 0.6426966 | 0.6044944 |
| Glossa | 35.4 | 15.1 | 49.5 | 0.7151515 | 0.3050505 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.8 | 30.8 | 37.7 | 0.9496021 | 0.81697613 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNGIIKNTLRPSIIKNLFSTTSSTGITCNQLRTLWNVSRQTQITSIVPIKLFKHENVFCN YNCCRNSHSKAEKELVEFLAEEIIAEKKAQKLKTIPTELDGFKVSLDGADVNLEKKQDNE IIRISFNINHTVDSESEPNVEMTNDNPDIGDMKSKPSFTIDIIRGNQTLGFTCSFNNEPG ASGANESYNDIFGIDEITLYTGEHTDKVYAVAGEIIDGYLYDLLMNYLEEKGISNEFAEK LIDLSTSYEHTAYVSLLEGLSKFTSGK |
 Top
| |