| Protein: 328782553 XP_397174.4 PREDICTED: glutamate--cysteine ligase regulatory subunit |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.1 | 54.9 | 0.8214936 | ||
| Scape | 47.4 | 52.6 | 0.9011407 | ||
| Brain | 19 | 81 | 0.2345679 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 25.7 | 40.8 | 33.5 | 0.7671642 | 1.2179104 |
| Leg, middle | 36.1 | 28 | 36 | 1.0027778 | 0.7777778 |
| Leg, rear | 45.2 | 27.3 | 27.4 | 1.6496351 | 0.99635035 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 55.2 | 44.8 | 1.2321428 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 20.9 | 79.1 | 0.2642225 | ||
| Thoracic muscle | |||||
| Fat body | 70 | 30 | 2.3333333 | ||
| Malpighian tubules | 32.7 | 30.5 | 36.8 | 0.88858694 | 0.8288044 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 36.5 | 63.5 | 0.5748032 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.2 | 32.3 | 49.1 | 0.8798371 | 0.65784115 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLSQNLLVRTGNILNLNEAKTKASQNPTDELIETLKIVLRDNEGIGENPIIIEGIEDNAL KDINREDVKITVKVFISSPDVNLLKEAIDQVCNSLNINAIESLVIAYSGKENSEDILSSL KHLWTGVEEYVKIGKLSSVGLSDVNTNEFIDLFQWANVKPNIVQISLATCCIVPPALQTF TKENDVQLLTHNDPGQILPQEDLNGIFNANTNVHWVTRYQIHLKCRGILSSKGYLIYVNK QTT |
 Top
| |