| Protein: 328789138 XP_003251234.1 PREDICTED: kynurenine--oxoglutarate transaminase 3-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.8 | 49.2 | 1.0325203 | ||
| Scape | |||||
| Brain | |||||
| Crop | 21.4 | 78.6 | 0.27226463 | ||
| Eye | |||||
| Intestine | 47.2 | 12.7 | 40.1 | 1.1770574 | 0.31670824 |
| Leg, front | 57.9 | 42.1 | 1.375297 | ||
| Leg, middle | |||||
| Leg, rear | 63.3 | 13.6 | 23.1 | 2.7402596 | 0.5887446 |
| Mandibular gland | 7.3 | 92.7 | 0.07874865 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 37.9 | 25.1 | 37 | 1.0243243 | 0.6783784 |
| Sternite | 58 | 42 | 1.3809524 | ||
| Tergite | 15.7 | 84.3 | 0.18623962 | ||
| Ventriculus | 11.4* | 88.6 | 0.12866817 | ||
| Thoracic muscle | |||||
| Fat body | 39.9 | 12 | 48.1 | 0.82952183 | 0.24948025 |
| Malpighian tubules | 31.3 | 38.7 | 29.9 | 1.0468228 | 1.2943144 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 26.9 | 28 | 45.1 | 0.59645236 | 0.6208426 |
| Hypopharyngeal gland | 58.5 | 41.5 | 1.4096385 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.6 | 30.7 | 53 | 0.6716981 | 0.57924527 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKHYMEAVAIGFEQELERFDQPDCYFVSLAKELTSKRDYMAKFLSDVGMSPTIPEGGYFM IANWTALKDKVNLEEETDEHRDYRFTKWMTKNVGVQGIPPSAFYSSEHKYLGEDNVRYCF IKKDENLKKAAEILMKWKSQE |
 Top
| |