| Protein: 66519842 XP_391905.2 PREDICTED: proteasome subunit beta type-7-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.7 | 24.7 | 31.6 | 1.3829114 | 0.7816456 |
| Scape | 34.9 | 29.6 | 35.5 | 0.98309857 | 0.8338028 |
| Brain | 57 | 43 | 1.3255814 | ||
| Crop | 32.1 | 36 | 32 | 1.003125 | 1.125 |
| Eye | |||||
| Intestine | 18.1 | 56.4 | 25.4 | 0.71259844 | 2.2204723 |
| Leg, front | 46.1 | 26.5 | 27.4 | 1.6824818 | 0.9671533 |
| Leg, middle | 45.3 | 26.8 | 27.9 | 1.6236559 | 0.9605735 |
| Leg, rear | 42.8 | 28 | 29.2 | 1.4657534 | 0.9589041 |
| Mandibular gland | |||||
| Rectum | 7.4 | 92.6 | 0.07991361 | ||
| Salivary gland, cerebral | 58.2 | 41.8 | 1.3923445 | ||
| Salivary gland, thoracic | 34.9 | 31.9 | 33.1 | 1.0543807 | 0.96374625 |
| Sternite | 29.3 | 39.6 | 31 | 0.9451613 | 1.2774193 |
| Tergite | 24.3 | 48.8 | 27 | 0.9 | 1.8074074 |
| Ventriculus | 25.1 | 41.6 | 33.3 | 0.7537538 | 1.2492492 |
| Thoracic muscle | |||||
| Fat body | 29.4 | 31.7 | 39 | 0.75384617 | 0.8128205 |
| Malpighian tubules | 26.4 | 33.7 | 40 | 0.66 | 0.8425 |
| Nerve chord | 30.4 | 29.8 | 39.8 | 0.7638191 | 0.7487437 |
| Poison sac | |||||
| Sting | 61.1 | 38.9 | 1.5706941 | ||
| Heart | 24.5 | 42.9 | 32.6 | 0.75153375 | 1.3159509 |
| Hypopharyngeal gland | 61.1 | 38.9 | 1.5706941 | ||
| Galea | |||||
| Glossa | 48.8 | 51.2 | 0.953125 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.5 | 39.8 | 37.7 | 0.86206895 | 1.0557029 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSVLVPEIPAPGFSFDLCQRNNFLIKKGFQAPRAVKTGTTIAGVVYKDGVVLGGDTRST ENTIVADKNCSKIHYLAENMYCCGAGTAADTEMTTQMISSQLELHRLNTNRMVPVCTANA MIKQLLFRYQGHIGAALILGGVDLDGPHLYCIYPHGSSDRHMYTSMGTGSLAAMAVFESR WKPDMTEEEAKELVADAIRAGVFNDLASGSNVDLCVIRKGSVDYLRPYDVANVKGQRNIS YRYKRGTTAVLNKTVHPIIIEGETVRRIEVEPMDTSS |
 Top
| |